KEGG   Python bivittatus (Burmese python): 103051673Help
Entry
103051673         CDS       T03091                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00561  Glycerolipid metabolism
pbi01100  Metabolic pathways
Module
pbi_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    103051673 (MGLL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pbi01002]
    103051673 (MGLL)
Enzymes [BR:pbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     103051673 (MGLL)
Peptidases [BR:pbi01002]
 Serine Peptidases
  Family S33
   103051673 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase Lipase_3 PGAP1 Abhydrolase_2 Thioesterase Abhydrolase_5 LIDHydrolase DUF2048 Abhydrolase_3 DUF1057 DUF2974 Chlorophyllase2 DUF900
Motif
Other DBs
NCBI-GeneID: 103051673
NCBI-ProteinID: XP_007437177
Position
Unknown
AA seq 230 aa AA seqDB search
HVGHGQSEGDRMVASDFRVFVRDSLQHIDLVKEEHPGVPVFLLGHSMGGAIAILTACERP
NDFSGMVLISPLVVASPDVATPIKVFAAKVLNFVLPNLSLGSIDPNVISRNKKEVESYRL
DPLVYHGGMKVSFVIQLLNTIAKIERSLPKLILPILVLHGSLDKLCDIRGSYFLMDTAPS
QDKTLKVYDEAFHALHKELPDVTTSVFKEIETWIGQKAAEEAHQSKQKPL
NT seq 695 nt NT seq  +upstreamnt  +downstreamnt
accatgttggccacgggcagagcgagggagaccgtatggttgcgtccgacttccgtgtgt
ttgtcagagacagcttgcagcacatcgatctcgtgaaggaggaacatccaggtgtccctg
tgtttcttctggggcactccatgggaggagccattgccatcctcaccgcgtgtgaaagac
caaatgacttttcaggcatggtattaatttctcctttagtagttgcaagccctgatgtag
cgacaccgatcaaggtatttgcagctaaagtacttaactttgtcctgccaaacttgtctc
tgggatccattgatccaaatgtcatttcccggaataagaaagaggttgaatcttaccgtt
tagaccctctggtctatcatggaggcatgaaagtctcctttgtcattcagctgctgaata
ccattgccaaaatagagcgttctctccctaaactgattctccccatcttggtgctccatg
gttcactggacaaactctgcgacatcagaggctcttacttcttgatggatactgccccaa
gtcaggataaaacactcaaggtatatgatgaagccttccatgccctccacaaagagcttc
ctgacgtgactacttctgtttttaaagaaatagaaacgtggattggccagaaagcagctg
aggaagcccaccaatctaagcaaaagccactctga

DBGET integrated database retrieval system