KEGG   Python bivittatus (Burmese python): 103052313
Entry
103052313         CDS       T03091                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
pbi  Python bivittatus (Burmese python)
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pbi01002]
    103052313 (ERAP1)
Enzymes [BR:pbi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     103052313 (ERAP1)
Peptidases and inhibitors [BR:pbi01002]
 Metallo peptidases
  Family M1
   103052313 (ERAP1)
SSDB
Motif
Pfam: ERAP1_C Peptidase_M1 MHB
Other DBs
NCBI-GeneID: 103052313
NCBI-ProteinID: XP_007437861
Position
Unknown
AA seq 621 aa
MENWGLTTYRESALLYDSEKSSASRKLGITLMVAHELAHQWFGNLVTMEWWNDLWLNEGF
AKFMEFVSVSKTHPELKVEDYFLNKYFDAMEVDVLDSSHPISTPVEDPAQILEMFDDVSY
DKGACILNMLQDYLSPEVFKAGLIKYLLRFSYQNTQNKDLWESLSDVCPTADGSQIQNEV
CIRNKERNLNSHWTKVALHDVQTVMNTWTFQKGFPLVTVTVKGKNVHLQQEHFSKNSSVS
TGNLWHIPLTYITNKCNDIQRFLLTTKTNDIVLPEEVEWIKFNVGMNGYYIVHYGDHGWD
ALIRLLKDNHETISSNDRASLINSAFQLVSAGKLSITKALDLTLYLKHESEVTPVYQGLN
ELIPLYKLLEKTNLSDTEQQLKAYIVNLFKNMIDKQSWDDKGTVPEQMLQSSLLTFACVR
KYQPCVDKAKEYFMKWKNSDGTLKLPNNVKMAVYAVGIQTDENWDFLFSKYQLPEFDTEK
NQIEAVLSLSQNKEKLQWLLDQALQGDIMKTQELPLILISVGRNPYGYQLAWKFFKQNWH
KLVKKFELGSASLARIISGITNQYSTREQLAEVKNYFSSMDKKTSELRAVQQAIETIEEN
IKWMDKNLEKIRTWLQINSKV
NT seq 1866 nt   +upstreamnt  +downstreamnt
atggaaaattggggattgaccacatacagggaatctgctttgttatatgattctgaaaaa
tcctcagcatcaaggaaacttggaattactttgatggtagcccatgaacttgctcatcag
tggtttggaaatttggtcacaatggaatggtggaatgatctttggcttaatgaaggtttt
gcgaagtttatggaatttgtatcagtaagcaagacccacccagaactaaaagttgaagat
tactttttaaacaagtattttgatgccatggaggtagatgttttagattcttcacatccc
atatcgactcctgttgaagatccagctcagattctagaaatgtttgatgatgtttcctac
gataagggagcttgtattctcaatatgctacaggattatctcagcccagaagtttttaaa
gctggtcttataaaatatttgttgcgattcagttatcagaacacacaaaacaaagattta
tgggagagcttgtcagatgtttgtccaactgctgatggaagccaaatacaaaatgaagtt
tgtatcagaaacaaggagagaaacttaaattcacactggaccaaagttgcactccatgat
gtgcagacagtgatgaacacttggacattccaaaaaggatttcctctagtgacagttact
gttaaaggaaaaaatgtccatctacaacaagaacatttttcaaagaactctagtgtatca
actgggaatctatggcatatcccattgacatatattaccaataaatgtaatgatattcag
aggttcttgctgacaaccaaaacaaatgatatagtcctcccagaagaagtggagtggata
aaatttaacgtaggaatgaatggttattatattgtgcattatggagatcatggctgggat
gctctaattcgcctgttaaaagacaatcatgaaacaataagcagcaatgaccgagcgagc
ctcattaacagtgcattccagctggtgagtgctggaaaactgtcaattacaaaagctctt
gatttaacattatacttaaaacatgaatctgaagttactcctgtatatcaaggcctgaat
gagctaatccctctgtataaactgctggagaagacaaacttaagtgacacagaacaacaa
ttaaaggcatatatagtcaatctatttaaaaatatgattgacaaacagtcatgggatgat
aaaggtacagtgcctgagcaaatgcttcagagctccctacttacatttgcatgtgtacgc
aaataccaaccatgtgtagacaaggcaaaagagtacttcatgaaatggaagaactcggat
gggactctcaagttgcccaataacgttaagatggcagtatatgcggttggaatacaaact
gatgaaaactgggatttcctttttagcaagtatcagctacctgaattcgacactgaaaag
aatcagattgaagctgtactcagtctgagccaaaataaagaaaagcttcaatggttactg
gatcaagcactgcaaggtgacataatgaagactcaggaacttcctcttatacttatcagt
gttggaaggaatccttatggatatcaattagcttggaagtttttcaaacaaaactggcat
aaacttgtaaaaaaatttgaacttggctcagcctcacttgcacgaataattagtggaata
acaaatcagtattccacaagggaacagcttgctgaggtaaaaaactatttcagctcaatg
gacaaaaaaacttcagagctccgtgctgttcaacaagcaatagaaaccattgaggaaaac
atcaagtggatggataagaaccttgaaaaaatcaggacatggttacaaatcaatagcaaa
gtgtga

DBGET integrated database retrieval system