KEGG   Python bivittatus (Burmese python): 103052483Help
Entry
103052483         CDS       T03091                                 

Gene name
MGAT2
Definition
(RefSeq) alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00510  N-Glycan biosynthesis
pbi01100  Metabolic pathways
Module
pbi_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    103052483 (MGAT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pbi01003]
    103052483 (MGAT2)
Enzymes [BR:pbi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     103052483 (MGAT2)
Glycosyltransferases [BR:pbi01003]
 Glycan extension
  N-Glycan
   103052483 (MGAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2
Motif
Other DBs
NCBI-GeneID: 103052483
NCBI-ProteinID: XP_025031604
Position
Unknown
AA seq 417 aa AA seqDB search
SKREEPASPPPPPPGDRPLPPAFTSSSLPVSGRLSNSSWLSREEAPGLNRTLHYRSLVYR
LNFDQPVRNEAHWRPGGSGTGTEEVAVALVVQVHERADHLRILLDSLRRAPGVEKVLLVL
SHDVWSAELNALAASVDFCAVLQIFFPFSLQLYPGEFPGTDPRDCPRDVGQEAALRSGCL
NAQYPDAFGHYREATFTQTKHHWWWKLHFVWERVRALREHPGLVVFLEEDHYLAPDFYHI
LQHLWALRQRDCPECQLLSLGTYATVRGSFAGRADKVELKTWKSTEHNMGMVFARDTYQQ
LIACTDAFCTYDDYNWDWTLQHLTVGCLPHFWKVLVPEIPRIFHTGDCGMHHKKSCQPSV
QSAKIDSLLNSNQQYLFPKTITISKRYSVAPLSPHVKNGGWGDIRDHELCKSYRRLQ
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
agcaaacgggaagaacccgcgtcgccgccgccgccgcccccgggagaccgaccgttgccg
ccggcctttaccagcagcagccttcctgttagcgggcgtctttccaattcgtcttggcta
tcgcgggaagaggcgccggggctgaatcgcaccctgcactaccggtcgctggtgtaccgg
ctcaacttcgaccagccggtgcgcaacgaggcgcactggcggcctggcgggagcggcacc
ggcaccgaggaggtggccgtggcgctggtggtgcaggtgcatgagcgcgccgatcatctc
cggatactgttggactcgctgcggcgcgcgcccggcgtggaaaaggtgctgctggtgctc
agccacgacgtgtggtctgccgagttgaatgcgctggccgcctccgtggacttctgcgcg
gtcctgcagattttcttcccgttcagcctgcagctctatccgggcgaattcccaggcacg
gatccacgcgactgtccgcgcgacgtgggccaggaggcagcgctgcgctcgggctgcctc
aacgcccagtaccccgatgcctttggccactaccgtgaggctactttcacccagaccaaa
caccactggtggtggaagcttcacttcgtgtgggagcgggtgcgggctctgcgggaacac
ccgggtttggtggtcttcttggaggaggaccactacctggcacctgacttctaccacatc
ttgcagcacctctgggccctgcgacaacgtgactgccctgagtgccagttgctgtccttg
ggcacctacgccactgtgcgcggcagctttgctggccgggctgacaaggtggagttgaag
acatggaagtctacagagcacaacatgggcatggtctttgctagggacacgtaccagcaa
cttattgcctgcactgatgccttctgcacctatgatgactacaactgggactggaccctc
cagcatttgactgtaggatgccttcctcatttctggaaggtgctggttccagagatcccc
cgaatcttccacactggtgactgtggcatgcaccacaagaagtcttgccaaccctctgtt
cagagtgccaaaattgactctctcttaaatagcaatcaacaatacttgtttcctaaaacc
ataactattagcaagcggtactcagttgcccctttgagcccccatgtgaaaaatgggggt
tggggtgatattcgggaccatgaactctgcaaaagttaccgaagattacagtga

DBGET integrated database retrieval system