KEGG   Python bivittatus (Burmese python): 103052991Help
Entry
103052991         CDS       T03091                                 

Definition
(RefSeq) 39S ribosomal protein L53, mitochondrial-like
  KO
K17434  large subunit ribosomal protein L53
Organism
pbi  Python bivittatus (Burmese python)
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pbi03011]
    103052991
Ribosome [BR:pbi03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    103052991
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRP_L53 DUF4135
Motif
Other DBs
NCBI-GeneID: 103052991
NCBI-ProteinID: XP_007432591
Position
Unknown
AA seq 106 aa AA seqDB search
MAYVFPKRAGVSLKQVKSVLVTFCPFESNVQSTRNFLQCLFEKKAYKSNLNCNVKTEVKH
DGSEPVIDITFADGDRLIMKGANLTTKEMLNAFNNRCRKKERSLAE
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacgtgttcccgaagcgggccggtgtgtccctcaagcaggtgaagagtgtcttg
gtcactttttgccctttcgagtccaacgtgcaaagcaccagaaattttcttcaatgccta
tttgaaaagaaggcatacaaatcaaacttgaactgcaatgtgaaaacagaggtaaaacat
gatggatctgaaccagttatagacatcacatttgctgatggtgacagactgattatgaaa
ggagccaatttaacaactaaagagatgttaaatgcattcaacaatagatgtcgaaagaaa
gagcgttcattggcagagtag

DBGET integrated database retrieval system