KEGG   Python bivittatus (Burmese python): 103053503Help
Entry
103053503         CDS       T03091                                 

Gene name
DOCK7
Definition
(RefSeq) dedicator of cytokinesis protein 7 isoform X3
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
pbi  Python bivittatus (Burmese python)
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pbi04131]
    103053503 (DOCK7)
Membrane trafficking [BR:pbi04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    103053503 (DOCK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N Elong_Iki1 TEA
Motif
Other DBs
NCBI-GeneID: 103053503
NCBI-ProteinID: XP_007421327
Position
Unknown
AA seq 2098 aa AA seqDB search
MAERRAFAQKISRTVAAEVRKQISGQYGGSPQLLKNLNIGGSISHHTTVPLTEPVDPVDL
EDYLLTHPLAVDSGPMRDLFEFPPDDIEVIYSPRECRTLVSAVPEESEMDPHVRDCVRSY
TEDWAIVNRKYHKLGTGFNPNTLDKQKERQKGLPKQIFESDEAPDGNSYQDEQDDLKRRS
MSIDDTPRGSWACSIFDLKNSLPDALLSNLLDRTPNEEIDHQNDDQRKSNRHKELFALHP
APDEEEPIERLGIPEIPKEHFGQRLLVKCLSLKFEIEIEPIFASLALYDVKEKKKISENF
YFDLNSEQMKGMLRPHVPPAAITTLARSAIFSITYPSQDVFLVIKLEKVLQQGDIGECAE
PYMILKEADAAKNKEKLEKLKSQSEQFCQRLGKYRMPFAWTAIHLMNIVSSAGSLERDST
EVEIATGERKGSWSERRNSSIVGRRSLERTTSGDEACNLTNFRPATLTVTNFFKQEGDRL
SDEDLYKFLADMKRPSSVLRRLRPITAQLKIDISPAPENPHYCLTPELLQVKLYPDSRVR
PTREILEFPARDVYIPNTTYRNLLYVYPQSLNFANRQGSARNITVKVQFMFGEDPSNAMP
VIFGKSSCAEFSKEAYTAVVYHNRSPDFHEEIKIKLPATLTDHHHLLFTFYHVSCQQKQN
TPLETPVGYTWIPMLQNGRLKTGQFCLPVSLEKPPQAYSVLSPEVPLPGMKWVDNHKGVF
NVEIIAVSTIHTQDPYLDKFFALVHALDEHMFPVRIGDMRIMENNLENELKSSISALNSS
QLEPVVRFLHLLLDKLILLVVRPPIIAGQIVNLGQASFEAMASIINRLHKNLEGNQDQHG
RNNLLTSYIYYVFRLPNTSPNSPSPAPGGLGGSVHYATMARSAIRPASLNLNRSRSLSNS
NPDISGTPTSPDDEVRSIIGSKATDRSCNRMSSHTETPSFLQTLTGRLPTKKLFHEELAL
QWVVCSGSVREAALQQAWFFFELMVKSIVHHLYFADKLDAPRKNRFPERFMDDIAALVST
IANDIVSRFQKDTEMIERLNTSLAFFLNDLLSVMDRGFVFSLVKTYYKQVSSKLYSLPVP
STLVSLRLDFLRIVCSHEHYVTLNLPCSLLTPPASPSPSVSSATSQSSGFSTNVQDQKIA
NMFELSVPFRQQHYLAGLVLTELAVILDPEADSLFGLHKKVINMVHNLLSSHDSDPRYSD
PQIKARVATLYLPLIGVIMESVPQLYDFTESHNQRGRPSCTAVEDYESEGGNMISQTVAM
AIAGTSVPQLTRPSSFLLASTTSRQHSTFSADSSRNLLICLLWVLKNADESVLQKWFTDL
SVLQLNRLLDLLYLCISCFEYKGKKVFERMNSLTFKKSKDMRAKLEEAILGSIGARQEMV
RRSRGQLERSPSGSAFGSQENLRWRKDMTHWRQNTEKLDKSRAEIEHEALIDGNLATEAN
LIILDTLEIIVQTVSVTESKESILGGVLKALLHSMACNQSALYLQHCFATQRALVSKFPE
LLFEEETEQCADLCLRLLRHCSSSISTIRSHASASLYLLMRQNFEIGNNFARVKMQVTMS
LSSLVGTSQNFNEEFLRRSLKTILTYAEEDLELKETTFPDQVQDLVFNLHMILSDTVKMK
EHQEDPEMLIDLMYRIAKGYQNSPDLRLTWLQNMAGKHSERKNHAESAQCLVHSAALVAE
YLSMLEDRKYLPVGCVTFQNISSNVLEESAVSDDVVSPDEEGICSGKYFTEAGLVGLLEQ
AADSFSMAGMYEAVNEVYKILIPIHEANRDAKKLATIHGKLQDAFSKIVHQDGKRMFGTY
FRVGFYGTKFGDLDEQEFMYKEPAITKLAEISHRLEGFYGERFGEDAVEVIKDSNPVDKC
KLDANKAYIQITYVEPYFDTYEMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFK
RKTILTTSHAFPYIKTRINVIHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQ
MVLQGSVGTTVNQGPLEVAQVFLSEIPNDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSL
IGPDQKEYQRELERNYHRLKEALQPLINRKIPQLYKAVLPAACHRDSFSRMSLRKMDI
NT seq 6297 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcgccgggcctttgcccagaagatcagcagaacggtggcagctgaagtacgg
aaacagatttcagggcaatatggaggatcaccacagcttctcaagaatcttaatattgga
ggcagcatttcccaccatacaactgtgccccttactgagcctgtggatccagtggatttg
gaagattaccttcttacacatccacttgcagtggattctggtcctatgagagacttgttt
gaatttcctcctgatgatattgaagttatctacagtcctcgagaatgcagaacattggta
tcagctgtaccagaggaaagtgaaatggacccccatgtgagggactgtgtaaggagttat
acagaagactgggctattgtgaacagaaagtatcacaaattgggcacaggatttaatccc
aataccttggacaagcaaaaagagaggcaaaaaggcctgcccaaacagatctttgagtct
gatgaagctccagatggcaacagttaccaggatgaacaagatgacctgaaaagacggtcg
atgtcaatagatgatacaccacgaggtagctgggcctgcagtatttttgatctgaaaaat
tcccttcctgatgctttgctctctaatcttctggatcgaacaccaaatgaagaaatcgat
catcaaaatgatgatcaaaggaaatccaacagacacaaggagctttttgcattgcatcca
gcaccagatgaggaggagcccatagaaaggctaggcattccagaaatccccaaagaacat
tttggtcaaaggcttctcgtcaagtgtttgtctttaaagtttgaaattgaaatagagcca
atttttgcaagtttggcattatatgatgttaaagaaaagaagaagatttcagagaacttt
tactttgatttaaactctgaacaaatgaaaggcatgttgcgtcctcacgtcccgcctgcg
gccataaccactttggctcgttcagccatcttttctattacatacccttctcaagatgtc
ttcctggtaataaagttggaaaaggtattacagcaaggagatattggggaatgtgctgag
ccatatatgattttgaaagaagcagatgctgcaaagaacaaggaaaagctagaaaaactg
aaaagccaatcagaacaattttgccaaagacttggaaaatatcgcatgccttttgcgtgg
actgctattcatttaatgaatatagtcagcagtgctggaagtttggaaagagattctaca
gaagtagaaattgccactggagaacgcaaaggatcttggtcagaaagaagaaattctagt
attgttggcaggcgttcgctagaaagaaccactagtggggacgaggcctgcaacctgact
aactttagaccagctaccctcacagtgacaaacttctttaaacaggaaggtgaccggttg
agcgatgaagatctgtacaaattccttgcggatatgaagaggccttcttctgttctaagg
cgtctaagacctatcacagctcaattgaagattgatatatctccagccccagagaatcca
cattattgtctaactccagagctattgcaagtaaaactttacccagatagcagagttcga
ccaacaagagagatcctggaatttcctgcaagagatgtttatattccaaatacaacttac
agaaatcttctatatgtttatccacaaagccttaactttgccaatcgccaaggatctgct
cggaatattactgtaaaagtgcagtttatgtttggagaggatccaagtaatgcaatgccg
gtaatctttggaaaatctagctgtgctgaattttcaaaagaagcttatacagctgttgtt
tatcataacagatctcctgattttcatgaagaaatcaagatcaaacttcctgctactcta
actgatcatcaccacctgctttttactttttatcatgtcagttgccaacagaaacaaaac
accccacttgagactcctgttggctatacgtggataccaatgttacaaaatggacggttg
aagacgggtcagttctgcctccctgtttctttggagaagccaccacaggcttattctgta
ctctctccagaggtgcccctgcctggaatgaagtgggtcgacaaccataagggagttttt
aatgtagaaataattgctgtgtcaactattcatacacaggacccctatcttgacaagttc
tttgcccttgttcatgccctggatgaacatatgttccctgtacggataggtgacatgaga
attatggagaacaacttggaaaatgaattaaagagcagcatttcagctttgaactcatct
cagctggagcctgtggtgcggtttctccatcttctgcttgacaaactgatccttttggtt
gtaagacctccaattattgcgggccaaatagtcaatctaggtcaagcatcttttgaagcc
atggcctctattataaacagacttcacaaaaaccttgaaggaaatcaagatcagcatgga
agaaataatcttcttacttcatacatttattatgtttttcggttaccaaatacttctccc
aattcaccatccccagctcctggtggtttaggaggatcagtacactatgctaccatggct
cgttcagctatcagacctgcaagcctaaacttgaatcgttctaggagccttagtaacagc
aacccagatatatctgggactccaacctcacctgatgatgaagtacggtcaatcattgga
agtaaggctacagatcgaagctgtaatcgtatgtcttcccacacagagacgccaagtttc
ttacaaacattaacagggcgattgccaactaaaaagctttttcatgaagaactggcttta
cagtgggttgtctgcagtggaagtgttcgtgaagcagctcttcagcaggcatggttcttt
tttgaacttatggtaaaaagtattgttcatcatttgtattttgctgacaaacttgatgca
ccgaggaagaatcgttttccagagcgcttcatggatgacatagctgcactggtcagcaca
attgccaatgatatagtctcccggtttcagaaggacacagaaatgattgaaagactcaac
actagtttagcattttttctcaatgatctattgtctgtaatggacagaggatttgtcttt
agccttgttaagacttactacaaacaggtgtcatccaagctttattctttaccagtcccc
agcacgcttgtgtccttgaggctggattttcttcggattgtctgtagccatgagcattat
gttactctgaatttaccatgtagtttgctaacaccacctgcatctccatcaccttcggtg
tcatcagcaacatcacagagttctggattctcaacaaatgtccaggatcagaagattgca
aatatgtttgagctgtctgtgccttttcgtcaacagcactatttggcaggattggtgctt
actgaactggctgtcattttagatcctgaagcagatagtttgtttggattgcataagaaa
gtcatcaatatggtacacaatttgctatccagccatgactccgacccacggtactctgac
ccacagataaaggccagggtggctactctatacttgcctctgattggagtgatcatggag
agtgtgccccagctgtatgatttcacagaaagtcacaatcagcgtggaagaccaagctgc
actgcagtagaggactatgaaagtgagggtgggaacatgattagtcaaacagttgctatg
gccattgcaggaacctctgtcccacagctcacccggcctagcagttttctcctcgcatca
acgaccagcaggcaacactcaacattttcagctgattccagtcgaaaccttttgatctgt
ctcttatgggtcctaaagaatgctgatgaaagtgttctgcagaaatggttcacagatctc
tctgtgttgcagcttaatcgtttgttggatttgctttatctttgtatttcctgctttgaa
tataaggggaagaaagtgtttgaaagaatgaacagtctgacttttaagaagtcaaaagat
atgcgggctaaacttgaagaagcgatacttggaagcattggggccaggcaagaaatggta
cgacgaagcagaggacaattggaaagaagtccttctggaagtgcttttggaagtcaggag
aacctgagatggcgaaaggatatgacgcattggagacagaacactgaaaaactcgacaag
tcccgggcagagattgaacatgaagcacttattgatggcaatttggcaacagaagccaat
ctgatcatattggatactttagagataattgtgcagactgtttctgtgactgaatccaag
gaaagtattcttggcggggtactgaaggctcttctgcatagcatggcctgcaatcaaagt
gctctttatctccagcattgctttgcgactcaaagagctttggtctcaaagttcccagaa
ctgctgtttgaagaagagactgagcaatgtgctgatctatgccttcgactcctgcgccac
tgcagcagtagcattagcacaatacgctcccatgccagtgcctctctgtatcttcttatg
aggcaaaacttcgagattgggaataactttgctagagtgaaaatgcaggtgactatgtca
ctctcatctctagtaggaacatctcaaaattttaatgaggagtttctgagacgttctctg
aaaaccattttgacttacgcagaagaggatctggaattaaaggagacaaccttccctgat
caggtccaggatcttgtgttcaatctccatatgatcctctctgatacagttaaaatgaag
gaacaccaggaagatccagaaatgctaattgacttgatgtacagaattgcgaaaggatat
cagaattccccagacctacgactaacctggctgcaaaacatggctggaaaacactctgag
agaaaaaaccatgcagaatctgcacagtgtttggttcactctgcagctctcgtggctgaa
tatctaagcatgctggaggatcggaaatatctccctgtaggatgtgttacatttcagaac
atctcttcaaatgttctagaagaatctgcagtttctgatgatgttgtctctccagatgaa
gaagggatatgttctggaaagtattttactgaagcaggtctggttggactgctggagcaa
gctgcagactctttctccatggctggtatgtatgaagcagtcaacgaggtttacaaaatc
cttattccaattcatgaagctaacagagatgccaagaaactggccacaattcatggtaaa
ctccaggatgcattcagcaagatagttcatcaggatggtaagcgaatgtttggtacatac
ttccgtgttggcttttatggaactaaatttggagatctggatgaacaggagttcatgtac
aaggaacctgcaataacaaaacttgctgaaatttctcatagattagagggattttacgga
gaaaggtttggtgaagatgctgttgaagttattaaggattctaatcctgttgacaagtgc
aaattagatgccaataaagcttatatacaaataacttatgtcgagccttactttgatact
tatgaaatgaaggacaggataacttattttgacaaaaactacaacttgcggcgattcatg
tattgtaccccgttcacgttggatggcagagctcatggggaattgcacgaacagttcaaa
aggaagactattttgacaacttcacatgcttttccttacattaagaccaggataaatgtc
attcacaaggaagaaataattttgacaccaattgaagttgccattgaggacatgcagaaa
aaaacccaagaactggcttttgcaacacatcaagatccagcagatccaaaaatgctccag
atggtgcttcagggttcagtaggcaccactgtaaatcaggggccactggaggttgcccaa
gtgttcttatctgaaatacccaacgatcctaaactctttcgccaccataacaaactacgg
ctttgtttcaaagactttacaaaaaggtgtgaagacgcactacgcaaaaacaaaagcttg
attggtccagaccaaaaagaatatcagcgggagcttgaaagaaattatcatcgtctcaag
gaagcccttcagcccctgatcaatagaaaaataccccaattatacaaggctgttcttcct
gctgcttgccacagagattccttcagcagaatgagccttcgcaaaatggacatctaa

DBGET integrated database retrieval system