KEGG   Python bivittatus (Burmese python): 103053529Help
Entry
103053529         CDS       T03091                                 

Gene name
MRVI1
Definition
(RefSeq) protein MRVI1 isoform X2
  KO
K12337  inositol 1,4,5-triphosphate receptor-associated cGMP kinase substrate
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103053529 (MRVI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRVI1 Med21
Motif
Other DBs
NCBI-GeneID: 103053529
NCBI-ProteinID: XP_007429419
Position
Unknown
AA seq 937 aa AA seqDB search
MFPNQFFVGQRWGFKENLLNSKRHASKTEYGQNNTRIFKVNTQISHENGVNCIHLPRYLG
VTQWSWDHNTPQYLSSEINLKQTFPSVLGLFNLHCIPTCPSPPIMPTLPEDVRQPTETQH
ANLPSLVKDSSADAATCNTPSIILPECAVRPVTDRETNVALRSVSPHLRHSNRNARKSAS
SLTSVDNEGHVIDLLNDQLPDIQISDEDKKKNIELLEEAKKVSERFLTRRGRKSRSSLSE
SPTALSPSLSPSVSPALSRSNSLTLPNPTDSDICTSIVESVPPLQNPTKGISNRKENDQR
KASQGRVVPHTAGLESPKEKLSEQKENFDPHKHMDDLSQFCTSDSNTGKISLSSSKNFCE
NELGKEFPKKNKGNDSPFKGHLHGPGIIALGTKLKGSAPLLKDSKVSCKTELHTSSNRSP
LLRAMSWDHAEPCDIEKAPFRPSEDTKNCATSNQSDNIPTKVPPFKDLQIQVQPVRMQKL
TKLREEHILMRNQNLVGLKLPDLSEAAEQERGSSPIPFSMEEEESKNRCDVMPNVPDTLL
RKLRVHTPLSGSSPPLTEREVENVFVQLSLAFRNDSYTLESRINQAERERNLAEENTEKE
LDNFKGAVTSSASLWHHSEHRDMYQKLLEDIAVLHRLASRLSSRAEMVGAVRQEKRMSKA
TEVMMQYVENLKRTYEKDHAELMEYKKLANQNSSRSYGSPDDGVPRTSRSMSLSIGKMPR
RRVSVAVVSKFELPGQSPSQSPVPLVSSSLSESSNGRSNLTSTPGLPVVIENGKPNSDLD
CEHPPSASAVGGLEEISPEAKAKIEEEAYNKGYQEGLKKTKESEELKEDNEEKMPEKPKG
FLAMETDDKISKPQSKLEVVIHYVQILYPKLHKHWNVLWIVAAIIIIFAIVLGTSSLYNY
FFSYTEGSDGPQVKPACSAAHQYSWGNSGLQHDQCTE
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atgtttcctaatcagttcttcgtgggtcaaagatggggattcaaagaaaatctcttaaac
agcaaaagacatgcatctaagactgagtatgggcaaaacaatacaagaatctttaaggtc
aacactcagattagccatgaaaatggagtaaattgcattcatctgccaagatatttaggc
gtgactcagtggtcctgggatcataacaccccacagtacttatcttcagagattaacttg
aaacagactttcccatcagtgcttggtctctttaatctgcattgcattccaacgtgccct
tcacctcccatcatgccaaccttaccagaagatgtcagacagccaactgagacacagcat
gcaaatttgccttctcttgtcaaagactcctctgctgatgcagctacatgcaacacacct
tcaataattcttccagagtgtgccgttagaccagttacagacagagagacaaatgtagct
ctcaggtctgttagccctcatctgcggcattctaacagaaatgctagaaaatcagcaagc
tctttgacttctgtagataatgaaggtcatgtaattgacctcctaaatgaccaactgccg
gatatacaaatatctgatgaagataaaaagaagaacatcgaactattagaagaagcaaag
aaggtgagtgagaggttcctcacacgtagaggaagaaaatcaagaagcagcctttcggaa
tcacccacagctttatccccatcactaagccccagtgtttcacctgcattgtctcggagc
aactcgttgactcttccaaatccaacagattctgatatatgcacgtccattgttgaatca
gtgcctccattgcagaatcccacaaaaggaatatctaatcgaaaggagaatgatcagaga
aaagcttctcagggaagagtggttcctcacacagctggtttggaaagtccaaaggagaag
ctgtctgaacaaaaggagaactttgacccacataaacacatggatgatctgtcccaattc
tgcacttcagattctaacactgggaaaatatctctaagtagcagcaagaacttctgtgaa
aatgaattagggaaagaattccctaaaaaaaataaaggaaatgactctccattcaaaggt
catttacatgggccaggaataattgccctgggcacaaagttaaagggctcagcaccactt
ctgaaggattccaaagtttcttgcaaaactgaacttcatacatctagtaatcgctctcct
ctgctccgagctatgtcatgggatcatgcagaaccatgtgatatagaaaaagcacctttc
agaccatctgaagatactaaaaactgtgctacgagtaatcagtctgataatataccaact
aaggttccaccgttcaaagaccttcagatacaagttcagccagttcgaatgcagaaactg
acaaagctcagagaggagcacatattgatgcgaaatcaaaatttagttggacttaaactt
cctgatctcagtgaagctgctgaacaggaaagagggtcttcaccaattcctttctcaatg
gaggaggaggagtcaaagaatagatgtgacgtcatgcccaacgttcctgacactctttta
cgaaaacttcgtgtacatacaccactttcaggaagttctcctccacttactgaaagagag
gttgagaatgtatttgtacaactttcattggcgttcagaaatgatagctatactttggaa
tcaagaattaaccaggctgaaagggagagaaatcttgctgaagaaaatacagagaaggaa
ttagacaactttaaaggagcagttacgtcttcagcttccttgtggcatcactctgaacac
agagatatgtaccagaagttgttggaagacattgctgtgcttcatcgtttggcttcaaga
ctgtccagtcgggctgaaatggttggagctgttcgtcaggagaaacgtatgtcaaaggcc
actgaagttatgatgcagtatgtagagaatttaaagagaacatatgaaaaggatcatgct
gagctcatggagtataagaaacttgctaatcagaattctagcagaagctatggttctcca
gatgatggtgtgccccgtacatctagatccatgtctctttctattggaaagatgcctcga
aggagagtcagtgttgctgttgtttcaaaatttgagcttccaggccagtcacctagccaa
tctcccgtacctttggtgtcatcttccctgtctgaatcatcaaatggaagaagcaatctg
acatcaactccaggcttacctgtagttatagagaatggaaaaccaaatagtgacctggat
tgtgaacaccctccttcagcatcagcagtaggtggcctggaagagatcagcccagaggca
aaagccaagatagaagaggaggcttacaacaaaggctatcaagaaggcctaaagaaaacc
aaggaaagtgaagagctgaaagaggacaatgaagagaaaatgcctgaaaagcccaaggga
tttttggccatggaaactgatgataagattagcaagccacagagcaaacttgaagttgtt
atccattatgtacagatactgtatcccaaactgcataaacactggaatgtgctctggatt
gtagcagccattattataatttttgcaatagtgctggggacctccagtttatacaattac
ttcttctcctatacggaggggtcagatggaccccaagtgaaacctgcctgttctgctgcc
catcagtattcttgggggaattcaggactacaacatgaccagtgcacagagtaa

DBGET integrated database retrieval system