KEGG   Python bivittatus (Burmese python): 103053818Help
Entry
103053818         CDS       T03091                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103053818
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pbi04030]
    103053818
G protein-coupled receptors [BR:pbi04030]
 Rhodopsin family
  Lipid
   Leukotriene
    103053818
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srv 7TM_GPCR_Srsx PIG-F VMA21
Motif
Other DBs
NCBI-GeneID: 103053818
NCBI-ProteinID: XP_007421152
Position
Unknown
AA seq 332 aa AA seqDB search
MALLHATEIPANLTGTKARWVETSLIPSMFLTICFLIGVPGNGLVVWTILSTFPQRSFTI
ALILNLAVADLMVMLTVPFWIYYFVKDWVFGDFMCRFLIYLVYLTVYASIFSITLLSLHR
FAVVVLPFASQRWRKPRGTHVVLLAVWLLAGVFSCPSLIFSSSQMTKGQCSDEFYEFDGQ
RLAVNIVETLFAFVIPFAVLAVCYTYVMRKIRTLKNHKKMKTGKLIAAVVGAFFVCWLPY
HVLNLIIISALLLKYAKPEVTQALLDSIKTLTNLHGAVAFLSSCINPILYAFAARSFRGG
LRETNFAKLFEKVHNDTEEKSAKDNTVSMQTL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggccctccttcatgccacagagataccagccaacctgacagggaccaaggcaagatgg
gtggagaccagcctgattccaagcatgtttcttactatatgcttcctgattggggtccct
gggaatggtctcgtggtctggactatcctttccacattcccccagcgctcattcaccatc
gccctcatcctgaacttagctgtggctgacttaatggtaatgctgactgtgcctttctgg
atttactattttgtcaaagactgggtttttggagacttcatgtgccgattcctcatatac
cttgtatatttgacagtctatgccagcatcttctccatcacgttattgagcctccaccgc
tttgctgttgtggtccttccattcgcttcccaaagatggcggaagccaagggggacgcat
gtcgtactgctggctgtttggttgctagcaggggttttctcctgcccgagcttgatattc
tcatccagccagatgaccaaagggcagtgctcggatgagttttatgagtttgatggccag
cgccttgcagttaacatcgtggagacactgtttgcctttgtgatcccttttgctgtgttg
gcagtctgctacacctacgtgatgaggaagattcggactctgaaaaaccacaagaaaatg
aaaactgggaagctgattgctgcagtagttggagccttctttgtttgctggctcccttat
catgtcttaaacctcatcatcatctctgcactgttgctgaaatatgccaagccggaggtg
acccaagctttacttgactccattaaaactttaacaaaccttcatggggctgtggccttt
ttaagcagctgcatcaaccctattctttatgcctttgcagcgcggagtttccgtggtggg
ctacgcgagacaaactttgcgaaattgtttgaaaaagtgcacaatgataccgaggaaaaa
tcagctaaggacaatactgtttccatgcagactctgtag

DBGET integrated database retrieval system