KEGG   Python bivittatus (Burmese python): 103054993Help
Entry
103054993         CDS       T03091                                 

Definition
(RefSeq) dual specificity protein phosphatase 10-like
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103054993
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc PTPlike_phytase Y_phosphatase Init_tRNA_PT DUF1877
Motif
Other DBs
NCBI-GeneID: 103054993
NCBI-ProteinID: XP_007438313
Position
Unknown
AA seq 607 aa AA seqDB search
MLLDDNCVAFGSPFPMPPSPLEERIGVLQRPKTLALRFSHSFVTHSSGGEKPLSPSATCR
VASQGPCDAARRSSVLLPGHPHALDLKLRVGGGPPGRGSERSFASLPDLKQAEKKGVLTP
QLKALLPQAKLKKRCFKENSKPTGDASPSSSSLSSPARAMHPLKCGCWGCWRLMRCEEAG
AKSSLRSLGCFSSRSSLRSLGCPGCSPQSMKKPGCFSCAPVALRSLACLTCNLSVKSASS
SCSFCSSDPIVAYDPRVGPSPAPSCYGGEDEEEEDDDDYTVRTIWPDELAKKMSKAHMQP
PQQGQQQTSPLILDCRNLVEFTKTQLQGAMRFGAPDAPGRRRFQQGKLAVLDFLSSRGTC
DGRDSSLQCLWSKEGNGCGGGAEPPPASPPKPPKTQPMQNLHLVLDLVHKDEQEGPGKRG
SPTGSDVPEISDDLVSPLTPDLENAELSPILPFLFLGNEKDAQNLEKMLHLNVGHVLNVT
THLPLYHADSGRLRYKRLPATDSNRQDLRQYFEEAFEFIEEAHQSGKGVLIHCQAGVSRS
ATIVIAYLMKHTLMTMGDAYKYVKGRRSVISPNLNFMGQLLQFETDLNAGVTPRILTPKL
AGVETEV
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgttattggatgacaactgcgttgcttttggctcacctttcccaatgccaccctcgcca
ctggaagagcggatcggcgtgctgcagagacccaagactttggctctccgtttcagccac
agctttgtcacccacagcagtggcggggagaagccactgtccccatccgcgacctgccga
gtcgccagccagggcccctgtgacgcggcccgccgaagcagcgtccttctccccggccac
ccgcacgccctcgacctcaagctgcgagtgggtggggggccaccaggtcgagggtcggag
cgcagctttgcctcactgccggacctcaagcaggctgagaagaaaggggtgctgaccccc
cagctgaaggcactcctgccccaggccaagctcaagaagcggtgtttcaaggagaactcc
aagccgacgggggacgcttcccccagctcctcctcgctctccagccccgcccgcgccatg
caccccttgaagtgcggctgctggggctgctggcggctgatgcgctgcgaggaggccggg
gcgaagtccagcctgcgctccctgggctgcttctccagccgttccagtttgcgctccctg
ggctgccccggctgcagcccgcagtccatgaagaagccgggctgcttctcctgcgccccg
gtggccctgcgctccctggcgtgcctgacttgcaacctctcggtcaagtccgccagctcc
tcctgcagcttctgcagcagcgaccccatcgtcgcctacgacccccgggtgggcccctcg
ccagctcccagctgctacggcggggaagacgaagaggaggaggacgatgacgactacact
gtccgcaccatctggcctgacgagctggccaagaagatgagcaaggcccacatgcagccg
ccgcagcagggccagcagcaaacgtcccccttgatcctggactgccgcaacctggtggaa
ttcaccaagactcagctgcagggcgccatgcgctttggggcacccgatgcgccaggacgg
cggcggttccagcaagggaaactggccgtgctggatttcctctcctcccgggggacctgc
gacggccgggactcctcgctgcagtgcctctggtccaaggaggggaacggctgcgggggg
ggtgcggaaccaccgccggccagtccccccaagccccccaaaacccagcctatgcagaac
ctgcaccttgtcctggatctggtccacaaagatgagcaagaagggcctggtaagagaggc
agtccgactgggtcagacgtcccggagatctcggacgacttggtctccccgctcaccccc
gacttggagaacgccgagctgagccccatcctccccttcctctttctgggcaacgagaag
gatgcccagaatttggaaaagatgcttcacctcaacgtgggccacgtcctgaacgtcacc
acccacctgccgctctaccacgccgacagcgggcgtctccgttacaagcgcctgcctgcc
accgacagcaaccgccaggatctgcggcaatacttcgaggaggcttttgaattcatcgag
gaggctcaccagagtggcaagggggtgctcatccactgccaggctggcgtctcgcgctcg
gccaccatcgtgatcgcctacctgatgaaacacaccctgatgaccatgggcgacgcctac
aagtacgtcaagggccgccggtccgtcatttcgcccaaccttaacttcatggggcagctc
ttgcagtttgaaacggacctcaacgccggcgtcacaccccgcatcctcacccccaagctg
gccggcgtggagaccgaggtgtga

DBGET integrated database retrieval system