KEGG   Python bivittatus (Burmese python): 103055695
Entry
103055695         CDS       T03091                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4 isoform X2
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00230  Purine metabolism
pbi01100  Metabolic pathways
pbi04020  Calcium signaling pathway
pbi04114  Oocyte meiosis
pbi04261  Adrenergic signaling in cardiomyocytes
pbi04270  Vascular smooth muscle contraction
pbi04371  Apelin signaling pathway
pbi04540  Gap junction
pbi04912  GnRH signaling pathway
pbi04914  Progesterone-mediated oocyte maturation
pbi04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103055695 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103055695 (ADCY4)
   04020 Calcium signaling pathway
    103055695 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103055695 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103055695 (ADCY4)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103055695 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    103055695 (ADCY4)
   04916 Melanogenesis
    103055695 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103055695 (ADCY4)
   04270 Vascular smooth muscle contraction
    103055695 (ADCY4)
Enzymes [BR:pbi01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103055695 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA
Other DBs
NCBI-GeneID: 103055695
NCBI-ProteinID: XP_007435451
Position
Unknown
AA seq 1080 aa
MPCQRRPRAASDTPREDLFYQTYYCLSQQYPLILLLLVIILSICVALIATTFGSGRDFSS
NLGFLVTLFTALLVFSLILVFVCMESIFQRCTRLFSAVIWTCLITMGYVFVFVGGVVCAW
DQVSFFLFIIFIVYTMLPVGMKDAVVAGVVASLSHIIVLSIYLSMSHNSHSQLAVQQLAN
LVIFVCGNLVGAYHKHLMEVALGETFHETFNLIQSRVKLESEKRHQEHLLLSILPAYIAL
EMKAEIIERLRDGGQPQRQHESANNFHNLYVKRHQNVSILYADIVGFTLLASECSPKELV
LMLNELFGKFDQIAKDNECMRIKILGDCYYCVSGLPVSLPNHAQNCVKMGLDMCRAIKKL
RDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSDDVTLANHMEAGGVPGRVHITEATL
SHLGGMYTVEEVCCVQRDSYLRENRIRTFLVVDPRAEEESSSDILSPVPGESFMMRASVR
MTRYLESWGAAKPFANLKHLDNLPADPPGFVRNNHSDISLGSLTMERCRAPRSPDEDLEG
VDEKFFQLIEQLNSQKQWKKSEDFNCITLYFKEESLEKEYRLSPLPSFNYYTACSFLVFV
SNFLVQILVVYKTEALGISYGISFFLFLLLLLTCFAAHLAKCFLKGPKILYWVPSILANV
CTQPWLRVSLGIITILVVLTMSVLNLFFMPETSCFLKLENSTLSGMNTVQEFSWLNSLFS
VPYYIYCCVLGFLSCSLFLHMNFELKLTMLILCLVVYNVLFLHTHSWLSDCYVSQLYRNQ
TALRPGVLKEPKMMGAFSFFVFFFTLLGLARQNEYYCRLDFLWKKKFKKEREEIETMENL
NRVLLENVLPADVAQQFIRQNRRNTDLYHQSYDCVCVLFASIPDFKEFYSESNVNHEGLE
CLRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAATGLNVAAGQDNQQDTERSYTHLG
TMVEFAMALVAKLDIINKHSFNTFKLRVGINHGPVVAGVIGAQKPQYDIWGNTVNVASRM
ESTGVLGKIQVTEETAKALETLGYTCTLRGVIKVKGKGELRTYFVCTETARSCSQAPMLS
NT seq 3243 nt   +upstreamnt  +downstreamnt
atgccctgccagcgtcgtccaagggcagccagtgacactccccgagaagacctcttctat
caaacctattactgcttgagccaacagtaccctctgattcttctcctcctggtcatcata
ttgagcatctgtgtggctctcatcgctacaacatttggcagtggtagggatttctcctcc
aacttgggcttcctggttacattattcactgctctgcttgtcttcagcctcatcttggtc
tttgtgtgcatggaaagcatcttccagcgatgcacccgcctcttctcagctgtaatttgg
acctgcctgatcacaatgggttatgtatttgtctttgttggtggagtggtttgtgcctgg
gaccaggtctccttcttccttttcataatcttcattgtctataccatgttgcctgttggc
atgaaggatgcagtagtcgcgggtgtagtcgcctctctctcgcacatcatagttctgagt
atctacctctcaatgagccacaattcacattcacaactggccgtgcagcaactggccaat
ctagtcatctttgtctgtggtaacttggtgggtgcctatcacaagcatctgatggaagtg
gccctgggggagaccttccatgagactttcaacctcatccaatctcgagttaagttagag
tcagaaaagcgacaccaggaacatttgctcctctcaatccttcctgcttacattgccttg
gagatgaaggctgagatcatcgagcggctccgggatggaggccagccacagcgccagcat
gaaagtgccaacaacttccacaacctttatgtcaagaggcaccagaatgtcagcatcctt
tatgcagatattgttggattcacacttttggccagtgaatgctctcccaaagagctggtc
ctgatgctcaatgaactctttggcaagtttgatcagattgccaaggataatgaatgcatg
cggatcaagatcttgggtgattgctactattgtgtgtctggattgcctgtatctttgcca
aaccatgcccagaattgtgtcaagatgggccttgacatgtgtcgggccatcaagaagcta
cgcgatgccactggagtggatatcaatatgagagttggagtccattcaggaaatgtcctc
tgtggggtgattggtctccaaaaatggcaatatgatgtctggtctgatgatgtgacatta
gccaatcacatggaagcaggaggcgtgccagggagagttcatatcacagaagccaccttg
tcacacctgggtggaatgtacactgtggaggaagtttgctgtgtgcagcgagattcttac
ttgagggagaaccgcatcaggaccttcttagttgttgatcccagggctgaagaagaaagc
tccagtgacattctctcacctgtgccaggtgagagcttcatgatgagggcctctgtccgg
atgactcgctacttggaatcttggggagcagccaaaccctttgccaacctcaaacatctg
gacaatctcccagcagacccaccaggatttgttcggaacaaccactcggatatctctttg
gggtctttgaccatggaacggtgccgtgcccccaggagtccagatgaagacttggaaggt
gtggatgagaagttcttccaactgattgaacagcttaactcccagaagcaatggaagaaa
tctgaagacttcaattgcatcacattgtacttcaaggaggaatctctggagaaggagtac
cggctctcgccactcccatcttttaattactatacagcctgcagcttcctggtcttcgtt
tccaactttctcgtccagatcctggttgtttataaaacagaagcattggggatctcctat
ggaatttctttcttcctctttctcctccttcttctcacctgctttgctgctcacctggcg
aagtgtttcctgaaaggtcccaagatcttgtactgggttccatccatcttggccaatgtt
tgcactcagccatggctacgtgtctccttgggcatcatcaccattcttgtggttctcaca
atgtcggtgttgaacttgttctttatgccagagacttcatgctttttgaaacttgaaaat
tctacattatcaggcatgaatactgtacaggaattctcttggcttaactcccttttcagt
gtgccgtattatatctactgctgtgtcctgggattcctctcgtgttccctctttctccac
atgaacttcgagctcaagttgaccatgctgatactgtgcctcgttgtctacaatgtgctg
tttcttcacacccattcatggctctctgactgctatgtctctcagctctaccgtaaccag
actgcactcaggcctggggtgctgaaggagcccaagatgatgggagcattctcgttcttc
gtcttcttcttcaccctcttgggtctggctaggcagaatgagtattactgccgcttagat
tttctctggaagaagaagttcaagaaagaacgtgaagagattgaaaccatggagaacctc
aaccgggtcctgctggaaaacgttctcccagctgatgtagctcagcagttcattcgccag
aaccgacgcaatacggatctttatcaccagtcttatgactgtgtctgtgttctcttcgct
tctatcccggacttcaaagaattttattctgaatccaacgttaaccatgaaggacttgaa
tgtcttcgactgctcaacgagatcattgctgactttgatgagcttcttctaaaacccaag
ttcagcggggttgagaagatcaaaaccattggcagcacttacatggcagctactggctta
aatgtggcagctggccaggataaccaacaggacactgaacggagctatacccacctggga
accatggtggagtttgccatggctttggtggccaagttggacattatcaacaagcactct
ttcaacactttcaaactccgtgtgggtataaatcatggaccagttgtggctggagtcatt
ggagcccagaaacctcaatatgacatttggggaaacactgtgaatgtagccagtcgaatg
gagagcacaggagttctggggaagatacaggtcacagaagaaacagctaaagctttggag
acattaggctacacttgcacccttcgtggggttatcaaggtgaagggcaaaggtgaactg
agaacttactttgtctgtacggaaacggcccgctcttgctcccaagcaccgatgttgagc
taa

DBGET integrated database retrieval system