KEGG   Python bivittatus (Burmese python): 103055699Help
Entry
103055699         CDS       T03091                                 

Definition
(RefSeq) ras association domain-containing protein 5-like
  KO
K08015  Ras association domain-containing protein 5
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103055699
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C1_1 C1_2
Motif
Other DBs
NCBI-GeneID: 103055699
NCBI-ProteinID: XP_025027652
Position
Unknown
AA seq 227 aa AA seqDB search
MAMASPAIGQYPYPLLLDREQQLFLQSLSANERKKILKGSASNDMKQPPPPPPPSCRGRP
LGSAVEAERGAAVGQAAEDGAEIPGAPLLPGKEAAMVAHLIPRELPASPGPAAKPFRSGQ
LHHQRLRLRSGAPRLLPDVRTIFEQPRDPRVREEKGEGHRFEGFALWRGWCDLCGEAVQQ
RAPRCANCKYTCHQECRRLIQLDCSHREGDTHNKPSPENTLTQNYCQ
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggccatggcttccccggccatcgggcagtacccttacccgctgctactggatagggaa
cagcagctcttcctgcagagcctgagcgccaacgaacggaagaagatcctcaagggctcc
gcttccaatgacatgaagcagccgccgccgccgccgcccccctcctgccgcgggaggccc
ctcgggagcgcagtggaagcagagcgcggggcggccgtcgggcaagcggctgaggacgga
gccgagattcccggggctcccctccttcctgggaaagaggctgcgatggtggctcactta
ataccccgggagctgcccgcttcccccggccccgcagccaagcccttccgctccgggcag
ctgcaccaccagcggctccgactgagatccggagctcctcgcctgctgcccgacgtgcgc
accattttcgagcagccgcgggacccccgagtgcgagaggagaagggagaaggacaccgc
ttcgaaggctttgccctctggaggggctggtgcgacctgtgcggggaggctgtgcagcag
cgggcaccgcgctgtgccaactgcaaatacacctgccatcaggaatgcagaagactcatc
cagctggattgcagccatcgggaaggagacacccacaacaaaccttcaccagaaaatacc
ttaacacagaactattgccag

DBGET integrated database retrieval system