KEGG   Python bivittatus (Burmese python): 103055923Help
Entry
103055923         CDS       T03091                                 

Definition
(RefSeq) succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00020  Citrate cycle (TCA cycle)
pbi00640  Propanoate metabolism
pbi01100  Metabolic pathways
pbi01200  Carbon metabolism
Module
pbi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pbi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103055923
   00640 Propanoate metabolism
    103055923
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pbi04147]
    103055923
Enzymes [BR:pbi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     103055923
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     103055923
Exosome [BR:pbi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103055923
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ligase_CoA Citrate_bind
Motif
Other DBs
NCBI-GeneID: 103055923
NCBI-ProteinID: XP_007432871
Position
Unknown
AA seq 190 aa AA seqDB search
LFQFYFLFHLVVCFDAKINFDDNAEFRQKKIFAMDDKSENEPMENEAACYDLKYIGLDGN
IACFVNGAGLAMATCDIISLNGGKPANFLDLGGGVKEAQVYQAFKLLTADPKVEAILVNI
FGGIVNCAIIANGITKACRELELKVPLVVRLEGTNVHEAQRILNESGLPITSASDLEDAA
KKAVASVTKK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
cttttccaattttatttccttttccatttagtggtatgctttgatgccaagataaacttt
gatgacaatgctgagttcaggcaaaaaaagatatttgccatggatgacaaatctgagaat
gaacctatggaaaatgaggctgcctgctacgacttgaagtatataggtctggatggaaac
attgcctgttttgtaaatggcgctggacttgcaatggcaacctgtgatataatttccctt
aatggtggaaaacctgccaacttcctggatcttggcggaggtgtaaaggaagcccaagtg
tatcaagcattcaaattgctcactgcagatcccaaggttgaagcaattttagtaaacata
tttggtggaattgtcaattgtgccattattgccaatggtatcaccaaagcttgtcgagag
cttgaattgaaagtgcctctagtggtccgacttgaaggaacaaatgttcacgaagcccag
cgcattctgaatgaaagtggactccccatcacttctgcaagtgaccttgaagatgctgct
aagaaagcagtggctagtgtgacaaagaaataa

DBGET integrated database retrieval system