KEGG   Python bivittatus (Burmese python): 103059344Help
Entry
103059344         CDS       T03091                                 

Definition
(RefSeq) rho-associated protein kinase 1-like isoform X2
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi04270  Vascular smooth muscle contraction
pbi04350  TGF-beta signaling pathway
pbi04510  Focal adhesion
pbi04530  Tight junction
pbi04810  Regulation of actin cytoskeleton
pbi05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    103059344
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103059344
   04530 Tight junction
    103059344
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103059344
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103059344
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103059344
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pbi01001]
    103059344
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pbi03036]
    103059344
Enzymes [BR:pbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103059344
Protein kinases [BR:pbi01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   103059344
Chromosome and associated proteins [BR:pbi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    103059344
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rho_Binding PH C1_1 DUF3153 PH_9 UPF0242 Spc7
Motif
Other DBs
NCBI-GeneID: 103059344
NCBI-ProteinID: XP_007435377
Position
Unknown
AA seq 370 aa AA seqDB search
MQYEKNLNNERTLKTQAVNKLAEIMNRKDFKLDRKKVNMQDFKKKEKENRKLQLELNQEK
EKSNQMAIKYQKELNEMQAQLVEESTYRNELQMQLDSKESDIEQLRSKILDLQQGMDSTS
VASLQADETDGNVTESRIEGWLSIPNKGNIKRYGWKKQYVVVSSRKILFYNDEQDKEQSN
PSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILYANEGECRKDLEVESVQPAEKTNF
LHHKGHEFVPTLYHFPANCEACAKPLWHVFKPPPAVECRRCHVKCHKDHLDKKEELIAPC
KVSYDITSARDMLLLAPCQEDQKKWVSHLIKKIPKTPPSSFVRASPRTLSTRSTANQSFR
KVKNTSGKAS
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatgaaaaaaacctgaacaatgaaaggacacttaagacacaggccgtcaacaaa
ttggctgagattatgaatcgaaaagattttaaactagatagaaagaaagtaaatatgcaa
gatttcaagaaaaaagagaaggaaaaccgaaagttacagttggaacttaaccaggaaaag
gagaaatctaatcagatggcaataaaatatcaaaaggaacttaatgaaatgcaagcgcaa
cttgtggaagagtccacatacaggaatgaacttcagatgcagctggatagtaaggagagt
gatatagaacaattgcgcagtaaaattttagacttgcaacaaggcatggactctactagt
gttgccagccttcaggctgatgaaacagatggaaatgttacagaatcaagaatagagggc
tggctttcaataccaaacaaagggaatattaaacgttacggatggaagaagcagtatgtt
gtggtcagcagcaggaagattctattctataacgatgaacaggacaaagagcaatctaat
ccatctatggtattagatatagataaattgttccatgttagaccagttacacaaggggat
gtttatagagcagaaactgaagaaatacccaaaatatttcagattctatatgccaatgag
ggggagtgtagaaaagatttggaagtagaatcagtacagccagcagagaagacaaatttt
ctgcatcataaaggtcatgaatttgtcccaactttataccattttccagccaattgtgag
gcttgtgccaagcctctctggcatgtatttaagccaccccctgcagtggaatgtcgccga
tgccatgttaagtgccataaagatcacttggataaaaaagaagaattaatagcaccatgt
aaagtaagttatgacataacttcagcaagagatatgttgctgttggcaccctgtcaggag
gatcagaagaaatgggtttctcatttaataaagaagatccccaaaacacctccatctagt
tttgttcgtgcttcacccaggactctttccacaagatctacagcaaatcagtcattcagg
aaagttaaaaatacttctggaaaagctagttaa

DBGET integrated database retrieval system