KEGG   Python bivittatus (Burmese python): 103059568
Entry
103059568         CDS       T03091                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00230  Purine metabolism
pbi00240  Pyrimidine metabolism
pbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103059568 (DCK)
   00240 Pyrimidine metabolism
    103059568 (DCK)
Enzymes [BR:pbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     103059568 (DCK)
SSDB
Motif
Pfam: dNK AAA_18 Thymidylate_kin AAA_28 AAA_33 MMR_HSR1
Other DBs
NCBI-GeneID: 103059568
NCBI-ProteinID: XP_007429814
Position
Unknown
AA seq 254 aa
MATPPKRSRSSVKKIAIEGNIAAGKSTFVNILKKAQKEWEVVPEPLARWCNVQNCQDDCE
ELTASQKSGGNLLQMMYEKPGRWSFTFQAYACLSRIRAQIQSFDGKLKEAENAVVFFERS
IYSDRYIFASNLYDSDCMNETEWTIYQDWHDWMNQQFGSSLELDGIIYLRATPEKCLNRI
YIRGRDEEQSIPIEYLEKLHHKHESWLQHRTLRMDFEYLQEVPILTLDVNEDFKSNKDKH
ENMIEKVQEFLSTL
NT seq 765 nt   +upstreamnt  +downstreamnt
atggcaaccccacccaagcgaagccggagcagcgtgaagaagatcgccatcgagggcaat
atcgctgcaggcaaatctacctttgtgaatattctcaaaaaagcccaaaaggaatgggaa
gttgttccagagccactggcaagatggtgcaatgttcagaactgccaagatgattgtgag
gagctgacagcctctcaaaagagtggtggcaacttacttcagatgatgtatgagaagcct
gggagatggtcctttacctttcaagcctatgcctgtctgagcagaatcagggctcagatc
cagtcttttgacgggaaactaaaagaagctgagaacgctgtggttttctttgaaagatcc
atttatagtgacaggtacatctttgcatccaatttatatgactctgactgtatgaatgaa
acagagtggactatttatcaagactggcatgattggatgaatcagcagtttggatccagc
cttgaactggatggcatcatctatctccgagctactcctgaaaaatgcttgaataggatt
tacatccgtggaagggatgaagaacaaagcattcccatagaatacctggagaagcttcat
cacaaacatgaaagctggctccagcacaggacgttacgaatggattttgaatacttgcaa
gaggtacccattctaacgctggatgtaaatgaagatttcaaaagcaacaaagacaaacat
gaaaatatgattgagaaggtccaagaatttttgagtactttgtag

DBGET integrated database retrieval system