KEGG   Python bivittatus (Burmese python): 103059580Help
Entry
103059580         CDS       T03091                                 

Definition
(RefSeq) arylamine N-acetyltransferase, pineal gland isozyme NAT-3-like isoform X1
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00232  Caffeine metabolism
pbi00983  Drug metabolism - other enzymes
pbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    103059580
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    103059580
Enzymes [BR:pbi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     103059580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2 Cohesin_HEAT
Motif
Other DBs
NCBI-GeneID: 103059580
NCBI-ProteinID: XP_025025502
Position
Unknown
AA seq 301 aa AA seqDB search
MKEGGKKSIMNIKDYFGRICYKGPQEKIDLETLTEVFQHHIRAVPFENLSLHCGETIQLD
LEPIYDKIVKHNRGGWCMENNQLLFWAFQTMGYKVSLLGACVYAPEQNAYHKDFSHLLIK
LVLEGKTYIVDGGFGVAYQMWEPMELISGKNQPQTPGLFCFTEKNGVWYFHKLKRKRFRM
DSDNRILCHDTVKNMACKNIYSFTLQPRTIDDFRPSCIKLQTDPSSMFLKKSICSLQTTD
GFLALIGWVLTETKYNYKDNMDLVEHTILTDEEVQKTLKERFRIQLDKKFVPLNNCSISM
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagggaggaaaaaaaagcatcatgaatattaaggattattttggaagaatttgt
tacaaaggtccccaggaaaaaatagacctagaaaccttaacagaagtctttcagcatcac
atccgtgctgtgccctttgaaaatctcagtctacactgtggtgaaaccattcagttggat
ttagaaccaatctatgacaaaattgtgaaacacaaccgcggcggatggtgcatggagaac
aaccagcttctattctgggccttccagactatgggctacaaagttagtcttttaggagcg
tgtgtttatgcccctgaacaaaatgcataccataaagatttctctcatctcctgattaaa
ttagttcttgagggcaaaacctacattgtagatggcggttttggggttgcttatcagatg
tgggaaccaatggaactgatttctgggaagaaccaacctcagactccaggcctcttttgc
ttcacggagaagaacggagtgtggtactttcacaaattaaagcgcaagcgattcaggatg
gattctgataacagaattctctgccatgatactgtaaaaaacatggcctgtaagaacatt
tactcatttaccttgcaaccaaggaccatagatgatttccggccctcctgtataaaactc
caaactgatccaagttctatgtttttaaagaaatccatctgtagtctccagactaccgat
ggatttctagctttgattgggtgggtgctgactgaaaccaaatataattataaggacaac
atggatctagtagaacacactatccttactgatgaagaagttcagaaaacactgaaggag
cgattcaggattcaactggataaaaaatttgtccctcttaacaactgctcaatatcaatg
ttttaa

DBGET integrated database retrieval system