KEGG   Python bivittatus (Burmese python): 103060123Help
Entry
103060123         CDS       T03091                                 

Gene name
BMPR2
Definition
(RefSeq) bone morphogenetic protein receptor type-2
  KO
K04671  bone morphogenetic protein receptor type-2 [EC:2.7.11.30]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi04060  Cytokine-cytokine receptor interaction
pbi04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    103060123 (BMPR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103060123 (BMPR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pbi01001]
    103060123 (BMPR2)
Enzymes [BR:pbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     103060123 (BMPR2)
Protein kinases [BR:pbi01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   103060123 (BMPR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Activin_recp APH FTA2 DUF3362
Motif
Other DBs
NCBI-GeneID: 103060123
NCBI-ProteinID: XP_007422081
Position
Unknown
AA seq 1041 aa AA seqDB search
MTDLLQHLLLVLLFSSATLQLSIAAVAQHEETMCAYRDPYQNDHGISESRISQENGTVLC
MKGSTCYGLWEKTREGEIHLVKQGCWTHIGDPQECHAEECIVTNTPSLVQNGTYRFCCCS
TNLCNVNFTENFPPPDPTEPPLNPSPRDETIIIALASVSVLAVLVAALFFGYRMFGGDRK
QGLHSMNMMEAAALEPSLDLDNLKLLELIGRGRYGAVYKGSLDERPVAVKVFSFTNRQNF
INERNIYRIPLMEHDNIAHFIVGDERFTADGRMEYLLVMEYYPNGSLCRYLTLHASDWVS
SCRMAHSITRGLAYLHTELPRGEHYKPAISHRDLNSRNVLVKNDGTCVISDFGLSMKLTG
NRLVRPGEEDNAAISEVGTIRYMAPEVLEGAVNLRDCESALKQVDMYALGLIYWEIFMRC
TDLFPGESVPEFQTAFQIEVGNHPTFEDMQVLVSREKQRPKFPEAWKENSLAVRSLKETI
EDCWDQDAEARLTAQCAEERMAELMMIWERNKSVSPTVNPMSTAMQNERNLSHHRRMAKI
RPYQEYSSSSFIEDSINHSDSKVKNISSELSMSSTPLTLGEKNRNSINYERQQAQARIPS
PETSVTSLSTNTTTTNTTGLTPSTGMTTISEMPYSGETNICAANGMQSLGPTPVCLQLTE
EDLETNKLDPKEVDKNLKESSDENLMEHSLKQFSGPDPLSSTSSSLLYPLIKLAVEATGQ
QDFMQVGNGQACLIPDVQPAQVYPLPKQQNLPKRPTSLPLNTKNSTKEPRLKFGGKHKSN
LKQVETGVAKMNTINAAEPHLVTVTTNEVAGRSHTTNSHPVSTQYANGTVPSGQTTTSGA
HRAQEMLQHQFSGEDSRLNINSSPDEHEPLLRREQQVSHDEGILDRLVDRRERSLENGRT
NTNNNNNNSGNLYLEQGVSTQSSRRTAPNSGPTHTRRAQRPNSLDLSATNILDGCNIQLG
ESSLEGKSGSGEKIKKRVKTPYSLKRWRPSTWVISTEPLDCEINNNGSDRVVSSKSSTAV
YLGEGGTATTMVSKDAGVNCL
NT seq 3126 nt NT seq  +upstreamnt  +downstreamnt
atgactgacttgctgcagcaccttttgctggtgctcttgttctccagtgccaccttacaa
ctcagcattgcggctgttgcccagcatgaagagacaatgtgtgcttatagagacccatac
caaaatgatcatgggattagtgaaagtcggatttctcaagagaatggtacagttttatgt
atgaaaggaagtacctgctatggtctctgggagaaaacccgagaaggagaaatacatctt
gtgaaacaaggatgttggactcatataggagacccccaagagtgccatgctgaagagtgc
atagtaacaaacaccccttcattagttcagaatgggacataccgtttttgttgctgcagt
accaacctgtgcaatgtcaacttcacagagaactttccaccaccagatcctacagagcct
cctttaaatccttctccacgagatgagacaattataattgctctggcatcagtatctgta
ctggctgttttggtggctgctcttttctttggatacaggatgtttggaggggaccgtaaa
caaggcctacatagtatgaacatgatggaagcagcagctttagaaccctcgttagatctg
gataatttgaaactactggagcttattggccgagggcgatatggagctgtatacaaagga
tccttagatgagcgtccagtggctgtaaaagtattttctttcactaatcgccagaatttt
ataaatgagagaaatatttatagaatcccactgatggaacatgacaatattgcccacttc
attgtgggggatgagagattcactgcagatggacggatggaatatttattagtaatggaa
tattatcccaatggttctttgtgcagatatttgactcttcatgctagtgattgggtgagt
tcttgccgaatggcacactctataactagaggcctggcatatcttcatacagaattacca
cgaggagaacattacaagcctgccatttcccatcgtgatttgaacagccgcaatgtatta
gtaaagaatgatggaacgtgtgtcattagtgattttggtctctccatgaagctaacagga
aatagattggtgcgcccaggtgaggaggacaatgctgcaattagcgaggttgggacaatt
cgctatatggcccctgaagtgctggaaggagcagtaaatttaagggactgtgaatcagct
ttgaaacaagtcgatatgtatgcactaggtctaatctattgggagatttttatgagatgt
acagaccttttcccaggagaatctgtgccagagttccaaacagcattccaaatagaagtt
ggaaaccaccccacttttgaagatatgcaagttcttgtttcaagagaaaagcaaagacca
aaattcccagaggcctggaaagagaacagcttggctgtgaggtcactgaaagagacaatc
gaagactgctgggatcaagatgccgaagctcggctgacagcccagtgtgctgaagagagg
atggcggaactcatgatgatttgggagaggaataaatctgtcagcccaactgttaaccct
atgtctacagctatgcaaaatgaacgaaatctgtcacatcatagacgaatggcaaagatc
agaccatatcaagagtattcttcctcatctttcattgaggattcaattaatcacagcgat
agcaaagtgaagaacatttcatctgaactttcaatgtcaagcacaccactgacacttggg
gagaagaacagaaattccattaactatgagcggcagcaagcacaagctcgtattccaagc
cctgagactagtgtcaccagcttgtcaaccaacactaccaccactaacacaactggcctt
actccaagcactggcatgaccaccatttctgagatgccttattcaggtgaaacaaatatt
tgtgctgcaaatggcatgcagtcacttggtccaactcctgtttgtctgcagctaacagag
gaggacttggaaactaacaagctggatccaaaagaagtggataaaaacttaaaagaaagc
tctgatgaaaacctgatggagcattctcttaaacagttcagtgggccagatccacttagc
agcactagttccagtttgctgtacccactgataaaactggcagtagaagcaacaggacag
caggacttcatgcaagttggaaatggccaagcctgtctaattccagatgttcagcctgct
caggtctaccctcttcccaaacagcagaacctcccaaagaggcctactagcctaccctta
aacaccaaaaattcaacaaaggagcctcggctgaagtttggagggaagcacaaatcaaac
ttgaagcaagtagaaaccggagttgccaagatgaatactataaatgctgcagaacctcac
ttggtaacagttacaacaaatgaagtggcagggaggagccatacaacaaactctcatcct
gtatcgacacagtatgccaatgggacagtgccatcaggccaaacaaccacctcaggagca
cacagagcccaggaaatgttgcagcatcagttcagtggagaggatagtcgtctgaatatt
aactcaagccctgatgaacatgagccgctattaagaagggagcagcaagtgagccatgac
gagggcattctcgatcgactggtagacagaagagaacggtcactggaaaatggccggaca
aataccaacaacaacaacaacaacagcggcaacctgtatctagagcaaggtgtttctacc
cagagcagccggagaacagcaccaaattctggaccgacccacactagaagagcgcagaga
cctaactcattggatctttctgccacaaatattttggatgggtgtaatattcagttgggt
gaatcatctcttgagggcaaatccggctcaggagaaaagatcaagaaacgtgtgaaaacg
ccttattccctaaagagatggcgcccttcaacatgggtcatctccacagaacccctggat
tgtgagattaacaacaatgggagtgacagggtggttagttctaaatccagtacagctgtt
taccttggagaaggaggtaccgcaacaactatggtgtctaaagatgcaggagtgaactgt
ctgtga

DBGET integrated database retrieval system