KEGG   Python bivittatus (Burmese python): 103061184Help
Entry
103061184         CDS       T03091                                 

Gene name
ALDOB
Definition
(RefSeq) LOW QUALITY PROTEIN: fructose-bisphosphate aldolase B
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00010  Glycolysis / Gluconeogenesis
pbi00030  Pentose phosphate pathway
pbi00051  Fructose and mannose metabolism
pbi01100  Metabolic pathways
pbi01200  Carbon metabolism
pbi01230  Biosynthesis of amino acids
Module
pbi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pbi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103061184 (ALDOB)
   00030 Pentose phosphate pathway
    103061184 (ALDOB)
   00051 Fructose and mannose metabolism
    103061184 (ALDOB)
Enzymes [BR:pbi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     103061184 (ALDOB)
Membrane trafficking [BR:pbi04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    103061184 (ALDOB)
Chromosome and associated proteins [BR:pbi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    103061184 (ALDOB)
Exosome [BR:pbi04147]
 Exosomal proteins
  Proteins found in most exosomes
   103061184 (ALDOB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 103061184
NCBI-ProteinID: XP_015742940
Position
Unknown
AA seq 362 aa AA seqDB search
MTHQFPTLSPEQKKALSDTAQRIVATGKGXADESVGTMGNRLQRIKVENTEENRRQFRDI
LFSSDRSINQQIGGIIFFHETLYQKDNTGKLFPAVIKDKGIVVGIKLDKGVAPLAGTNNE
TSIQGLDGLAERCAQYKKDGADFGKWRAVLKITDTTPSTLAIQENANILARYASICQQHG
LVPIVEPEILTDGDHDLQQCQYVTEKVLAAVYKALNDHHVYLEGTLLKPNMVTAGQACPK
KYTPQDVAMATVTALLRTVPAAVPGICFLSGGQSEEEASINLNAINQCPLPKPWKLTFSY
GRALQASALAAWSGKPENKKAAQEAFIKRAKINGLACKGQYVTSEKSSGAATQSLFSPSY
TY
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgacccaccagtttccaacgctctctccagagcagaaaaaggcactctctgacacagct
cagcggattgtagctaccggcaaagggnctgcagatgaatctgtaggaacaatgggtaac
aggctgcaacgcatcaaagtggagaatacggaagaaaatcgccgtcagttccgtgatatt
ctcttctcttccgaccgctccatcaaccaacagattggggggattattttcttccatgag
actctctatcagaaggacaacactggaaaactcttcccagctgtcattaaggacaagggc
atagtggttggaatcaagctggataaaggtgtggctccattggcaggaactaacaatgaa
accagcattcaaggtctggatgggctcgctgagcgctgtgcccagtataagaaagatgga
gcagattttggcaagtggcgtgccgtgctgaaaattacagacacaactccctctactctc
gccatccaggagaacgctaacatattggcacgctatgctagtatctgccaacagcatggc
ttagttcctattgtggaacctgagatcctaaccgatggggaccatgacctccagcaatgt
cagtatgtgactgaaaaggtgctggctgctgtttataaggccttgaatgaccaccatgtc
tatttggagggaacgctgctgaagcccaacatggtgaccgctggacaggcttgtcccaag
aaatacaccccacaggacgtggccatggcaacagttacagctctccttcggacagtcccc
gcagctgttccaggaatctgcttcctttctgggggccaaagtgaagaggaggcatccatt
aacctcaatgctatcaatcagtgcccactgcctaagccctggaagctgaccttctcctat
ggacgagctctgcaagcatcggctctagcggcctggtctggcaaaccggagaataagaag
gctgcccaagaggccttcatcaaacgggcaaagattaatggcttagcttgcaaaggccag
tatgtcacatccgaaaagagcagcggagcagccacccagtcactctttagtcccagttac
acatactag

DBGET integrated database retrieval system