KEGG   Python bivittatus (Burmese python): 103062639Help
Entry
103062639         CDS       T03091                                 

Gene name
PCBD1
Definition
(RefSeq) pterin-4-alpha-carbinolamine dehydratase isoform X1
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00790  Folate biosynthesis
pbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    103062639 (PCBD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pbi04147]
    103062639 (PCBD1)
Enzymes [BR:pbi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     103062639 (PCBD1)
Exosome [BR:pbi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103062639 (PCBD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-GeneID: 103062639
NCBI-ProteinID: XP_007432813
Position
Unknown
AA seq 104 aa AA seqDB search
MAGKAHRLSGEEREQLLPNLRAVGWNEVEGRDAIYKEFHFKDFNRAFGFMTRVALQAEKL
DHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVANTLA
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaaaagcccaccgactgagcggtgaagagagagaacagctcctgccaaatctc
agagcggtaggatggaacgaggtggaaggcagagatgctatctacaaggagttccatttc
aaggacttcaatcgggcctttggatttatgaccagagtagctctacaagcagaaaaactg
gatcatcatcctgaatggtttaatgtttacaacaaagttcatataaccttaagcacgcac
gagtgtgctggcttatctgagcgggacatcaacttggccagtttcatagagcaagttgca
aacacgctagcctaa

DBGET integrated database retrieval system