KEGG   Python bivittatus (Burmese python): 103062751Help
Entry
103062751         CDS       T03091                                 

Definition
(RefSeq) retinal guanylyl cyclase 2
  KO
K12322  guanylate cyclase 2F [EC:4.6.1.2]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00230  Purine metabolism
pbi01100  Metabolic pathways
pbi04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103062751
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    103062751
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pbi01001]
    103062751
Enzymes [BR:pbi01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     103062751
Protein kinases [BR:pbi01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   103062751
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Guanylate_cyc Pkinase_Tyr Pkinase HNOBA Catalase_C Kinase-like Dynein_AAA_lid
Motif
Other DBs
NCBI-GeneID: 103062751
NCBI-ProteinID: XP_007443714
Position
Unknown
AA seq 1019 aa AA seqDB search
MVLILSPVCCKVFKIGLVGPWSCNSFFSNTFPQVAAQLAMERIRKDLSITAVHQMDYVVF
EEDCQTWKAIARFAGSTEHLSAFIGPLNPGYCDTASSLTRGWNKTMLSWVCLNDELDNPI
HHPTFARTLPSSATVLLTVLRYFSWAQVGIVSSKEDLWVDTANKLASALRSHGLLVAIVA
STGTEAGIVEETWTKIQAAGNVKVLVLCMPSALIGGEDQATFLSKAQELGLTNGRYVFVP
YDTLFYSLPYGNHSYFLLENDDTFREAYDAVLTITLQSGERTFYEAFRAAKKKGEITVDL
EPEQVTPLFGTIYNAIYLVAKALAKVAQPETSELSGATLIQHVRNFDFAGFSHRIQVDSK
GRPLARYVILDTDGKKSHLFPTYVLAASSGVIQPLGRAIHFPGGRSPPADSACWFNPDVL
CKRDDLYPGPLIVILLLLPPVFLLLFGLYLAYLIRNSNPSRQVVKGSQKLLLTLDDLTFV
NTKISRMRLTLDNLSETRSGSEVHSLRSVTRSLSVKSTTLTYETSNVAVYEGDWVWLKKL
ETRVTGDRRHPATCVLTKMRDLRHENVNPFLGLLSDTGLSAVVMEFCSRGSLEDLLQNID
IKLDWMFKSSLLMDLIKGMKYLHSQNVSHGRLKSRNCVVDGRFVLKITDYGYGELLAAQG
IRQVETPPEELLWTAPELLRDSEVDPKGTFKGDVFSFAIILQEVILRGPPYCMLEIPAEE
IISKLKIPLPLFRPSVPLENTPLEYIQLMKQCWSEVPNRRPTFDKVFEQFKTINKGKRMN
IIDSMLRMLEKYSSNLEELIRERTEELEMEKQKTEKLLSQILPLSVAETLKTGASVEPEY
FEEVTIYFSDIIGFTTMCTLCEPIEIVDLLNDLYTLFDAIIGHHDVYKVETIGDAYMVAS
GLPKRNGHRHAAEIANMALDILSSVGAFKVKHIPNLPIKIRMGLHSGPCAAGVVGLTMPR
YCLFGDTVNTASRIESTGLPFRIHISQNTMKILHNLKEGYKMDFRGKTELKVRTITQQV
NT seq 3057 nt NT seq  +upstreamnt  +downstreamnt
atggtcctgatcctttccccagtctgttgcaaggtctttaagatcggtctggtggggcct
tggtcctgcaactccttcttttccaacacctttccccaagtggctgctcagttagccatg
gagagaatcaggaaagatctctctatcactgctgtccatcaaatggattacgtagtgttc
gaggaagattgccagacttggaaagcaattgctagatttgctggctccaccgagcatctg
tcagcattcataggacctctgaatcctggctactgtgacactgcttcatcgctaaccaga
ggctggaataaaaccatgttatcttgggtttgcctaaatgacgaactggataatccaatt
caccacccaacatttgcaagaactttgccttcttcagctactgtcctcctcaccgtgttg
agatattttagctgggctcaggtcggcatcgtctcttccaaagaagacctttgggtggac
acagccaataagctagcaagtgctctcagaagccatgggctacttgtggctattgttgcc
tccacagggacggaagcaggaattgtagaagagacttggacaaagattcaagctgctgga
aacgtcaaagtcctggttctctgcatgccttctgctctcattggaggggaagatcaagct
actttcctaagcaaagcccaggaactggggctgaccaacggcagatacgtctttgtgccc
tacgatactctgttctacagcctgccatacgggaaccattcatattttcttcttgaaaat
gatgacaccttccgggaggcttatgacgctgtgctgacaattactttgcagtctggagaa
aggactttttacgaagccttccgggcagccaagaaaaagggtgaaataacagtggatttg
gaaccagaacaggtcactccactttttgggacaatctacaatgccatttacctggtcgcc
aaagctttagccaaggtagcccagcccgagacttctgaactctctggagcaacgttgatt
caacatgtcagaaatttcgactttgccggcttcagccacaggatacaggtcgacagcaaa
ggaaggccactggccagatacgttattctggacacggatggcaagaaaagtcacctcttc
cccacttacgtgctggctgcatcttctggcgtgatacagcccctggggagggcaatacat
ttccctggagggaggtcacccccagctgattcggcctgctggtttaacccagatgtcctc
tgcaagagagatgacctatatccagggccgctgattgtgattttactactgttacctccc
gtcttcctgctcctcttcggcttgtacctggcgtacctcatcaggaacagtaaccccagt
cgccaagttgtcaaaggatcgcagaagctattactgactttagatgatctgacttttgtg
aacaccaaaatcagtagaatgaggttaactctcgacaacctcagtgagaccaggagcggc
tcagaagtacacagcctgagatctgtgacccgttcgttgtcggtgaaaagcacaactctt
acctatgaaacctctaatgtggctgtgtatgagggagactgggtatggctgaagaaactg
gagactagagtgaccggtgatcggaggcaccctgctacctgtgtgctcaccaagatgagg
gacctacgccatgaaaatgtgaacccgttcctaggtcttttatccgacacgggtctttct
gcagttgtgatggaattctgctccaggggaagtctagaggacttgctgcaaaacattgac
ataaagttagactggatgtttaaatcatctcttttgatggatttaattaaaggaatgaaa
tacttacacagccagaatgtcagccacgggcgcctcaaatcccgcaactgtgtggtggac
ggacggtttgtgctgaaaatcaccgactacggctacggcgagctcctggcagcccagggc
atccgtcaggttgagacccccccagaagaattgctctggaccgctcctgaattactgaga
gactccgaggtggaccccaaaggcacctttaaaggtgatgtgtttagttttgccattatc
ctgcaagaagtcattcttcgggggcccccctattgcatgttggaaataccagctgaagag
attataagcaagttgaagattcccctgcctttgtttcgtccaagtgttcctctggaaaat
acccctttggaatatatccagctgatgaagcagtgctggagtgaagtgccaaatcgaaga
ccaacgtttgacaaggtttttgaacagttcaaaacaatcaacaaaggaaaacggatgaat
atcattgactccatgctgcggatgttagaaaagtattccagcaatcttgaagaattaatc
agagagagaacggaagaattggagatggaaaagcagaagacggagaaactgctgtctcag
atccttcctttgtcagtggcagaaacgctgaaaacaggagcctctgttgagccagaatat
tttgaagaggtcaccatttacttcagtgacatcattggcttcaccaccatgtgcaccctc
tgcgagcctattgaaattgtggacctcctcaatgacctctacactctctttgatgccatc
ataggtcaccatgatgtttacaaggtggagaccattggtgacgcttacatggtggcgtca
gggcttccgaaacgcaacggccacaggcatgcggctgagatagccaacatggctctggat
atcctcagttcagtgggagctttcaaagtgaaacacatccctaatttgcctattaagata
cgaatggggctgcattcaggcccgtgtgctgcaggagtggtgggtctcaccatgcccagg
tactgtctgtttggagacacagtgaacacggcttcacggatagagtccaccggattgcca
ttcaggattcacatcagccaaaatacaatgaagatacttcacaatcttaaagaaggttac
aaaatggatttcagggggaagacagagctgaaggtaagaaccataacccagcaagtg

DBGET integrated database retrieval system