KEGG   Python bivittatus (Burmese python): 103064022Help
Entry
103064022         CDS       T03091                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00010  Glycolysis / Gluconeogenesis
pbi00562  Inositol phosphate metabolism
pbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103064022 (MINPP1)
   00562 Inositol phosphate metabolism
    103064022 (MINPP1)
Enzymes [BR:pbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     103064022 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     103064022 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708
Motif
Other DBs
NCBI-GeneID: 103064022
NCBI-ProteinID: XP_015746961
Position
Unknown
AA seq 332 aa AA seqDB search
MRMLARRLAARFPSLLAPGRRLAFASSSKHRCLDSSAAFREGLREALYGPRSDDGRNATM
METFEINDKLMRFFDHCEKFVRDIENNDSALHEVDAFKEGPEMKKIVNKTAHTLCLPLKD
LNADLVQVAFFTCSFGLSIKNISSPWCSLFNKEDAKVLEYLNDLKQYWKRAYGYNINSQS
SCILFQDIFKHLDQAVTESKRSKPISSPVSIQFGHAETLQPLLTLMGYFKDKVPLNASNY
SSHLNRRFRTGRIVPYAANLLFVLYHCDQARSPEEEYKVQILLNEKLLPFTYSGKTVSLY
AKLKNHYKDLIQNCEFAEVCSISKNGTSINSL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgctggcccggcgcctggccgcccgcttccccagcctcctggcccccggccgg
cgcctggccttcgccagcagctccaagcaccggtgcctggacagcagcgccgccttccgc
gaggggctgcgagaggcgctttacgggccgcggagcgacgacgggagaaacgccaccatg
atggaaacatttgaaattaatgataaattgatgagattttttgatcactgtgaaaaattt
gtacgagacattgaaaacaatgattcggcattacatgaggtcgatgcctttaaggaaggc
cctgagatgaagaagatagtgaataaaactgcacatactttgtgtctaccattgaaagac
ttaaatgcagatttggttcaagtggcattttttacttgctcatttgggctaagtataaaa
aacattagctccccctggtgttcgctgttcaacaaagaagatgccaaggtacttgagtat
ctgaatgacctcaaacagtactggaagagagcctatggatataatattaacagtcagtcc
agctgcatacttttccaagatattttcaaacatttggaccaggcagttacagagagcaaa
aggtcaaaacctatttcttcgccagtgagtatccagtttggacacgcagagactcttcag
ccacttcttacactcatgggctattttaaagataaggtgcctcttaacgccagcaactat
tccagtcacttgaatcgcaggttccgtactggtcgtatcgtcccttatgctgccaacttg
ttatttgtgctttatcattgtgatcaagctagatctcctgaggaagagtacaaggttcag
atccttctcaacgagaagctcctgccctttacatactcagggaaaactgtttctttgtac
gccaaactgaaaaaccattataaagatttaattcagaattgtgagtttgctgaagtgtgc
agtatctccaaaaatggtactagcattaattcattataa

DBGET integrated database retrieval system