KEGG   Python bivittatus (Burmese python): 103064998Help
Entry
103064998         CDS       T03091                                 

Gene name
GMPPB
Definition
(RefSeq) mannose-1-phosphate guanyltransferase beta
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00051  Fructose and mannose metabolism
pbi00520  Amino sugar and nucleotide sugar metabolism
pbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    103064998 (GMPPB)
   00520 Amino sugar and nucleotide sugar metabolism
    103064998 (GMPPB)
Enzymes [BR:pbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     103064998 (GMPPB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep Hexapep_2 DUF4954 IspD CTP_transf_3
Motif
Other DBs
NCBI-GeneID: 103064998
NCBI-ProteinID: XP_007428476
Position
Unknown
AA seq 360 aa AA seqDB search
MKALILVGGYGTRLRPLTLSIPKPLVEFCNKPILLHQVEALVKAGVNHVILAVSYMSELL
EKEMKEQEQRLGIQISLSHEKEPLGTAGPLALAQELLAENSEPFFVLNSDVICDFPFTDM
VHFHRHHGKEGTIVVTKVEEPSKYGVVVCEADTGLIHRFVEKPQVFVSNKINAGMYILNP
SVLKRIQLRPTSIEKEIFPVMAEEGQLYAMELHGFWMDIGQPKDFLTGMCLYLQHLRLKQ
PERLHSGSGYMGNVLVDPSAKIGSNCSIGPNVTIGAGVVVEDGVRIKRCTVLKGSRIRSH
SWLESCIVGWSSSVGQWVRMENVTVLGEDVIVNDELYLNGANVLPHKSIAESVPEPRIIM
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgctgatcctggtggggggctacggcacccggctgcgacccctgaccctcagc
atccctaagccgctggtcgaattctgtaacaagcccatcctgttgcaccaggtggaggcc
ttagtaaaggcaggtgtaaatcatgtgatccttgctgtaagctatatgtcagaactactg
gagaaggagatgaaagaacaagagcaaaggttgggcattcagatttctctgtcgcatgag
aaggaaccactgggcacagctggcccactggcactagcacaggagcttttggctgaaaat
tcagagcctttttttgtactcaatagcgatgtgatctgtgattttcccttcacagacatg
gtgcactttcacaggcatcatggaaaagaaggcactattgtggtgacaaaagtggaagaa
ccctccaaatatggtgtagttgtgtgtgaggcagatactgggctcatacatcgctttgtg
gagaaaccccaggtttttgtttccaataaaatcaatgctggcatgtacatcttaaatcca
agtgtattaaagcgcattcagttgcggcctacctcaattgagaaagaaatatttcctgta
atggcagaggaaggacaactctatgccatggaactacatgggttctggatggatattggg
cagccgaaagatttcctgactggcatgtgcctgtatctacaacatttgcggctgaagcag
cctgagcggttacattctggatcgggctatatgggaaatgtactagtggacccaagtgcc
aagattggatcaaactgcagtattggtcccaatgtcactattggggcaggagttgtggta
gaggatggtgttcggatcaagcgctgcactgttctaaaggggtcacgcatccgttcccac
tcttggctcgagtcctgtattgttgggtggagctcctctgtgggtcaatgggtgcggatg
gagaatgtaactgtgttgggggaggatgtcattgtgaacgatgaactctacctcaatggg
gccaatgtgctgcctcacaaatccattgctgaatcagtcccagagccacgcatcatcatg
tag

DBGET integrated database retrieval system