KEGG   Python bivittatus (Burmese python): 103065660
Entry
103065660         CDS       T03091                                 

Gene name
RDH5
Definition
(RefSeq) 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    103065660 (RDH5)
Enzymes [BR:pbi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     103065660 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR
Other DBs
NCBI-GeneID: 103065660
NCBI-ProteinID: XP_007435496
Position
Unknown
AA seq 319 aa
MWCCVLLISVVWAVVWFFRDRQTLSNFKDKYIFITGCDTGFGNMLAKKLDKKGFQVLAGC
LTQKGADSLERTSSPNLRTILLDVTSSKSICKAVEWVKAEVGRKGLFGLVNNAGIGSSIG
PTEWMTVEDYRKVMAVNTFGMIEVSLAFLPLLKQAHGRVVNMSSVLGRLSANGGGYCISK
YTVEAFSDSLRRDMYHFGVKVSIVEPGFFKTAMTDLGSIEASLRQHWDRMSLEAQRSYGD
QFFHSYLKVQKFIMNIICDSDLSKVTNCMEHALQAKHPRSRYSAGWDAKFLWLPVSYLPA
FLVDIFLSMILPKPAQRVR
NT seq 960 nt   +upstreamnt  +downstreamnt
atgtggtgctgcgtactactcatcagtgtggtttgggctgtggtctggttcttccgtgac
cggcagactttgagcaacttcaaagacaagtatattttcatcacgggttgtgacacaggt
tttgggaacatgctagccaagaaacttgacaagaagggtttccaagtgctggcaggctgc
ctgactcagaaaggagctgatagcttggaacgcaccagctcacccaacctgcgcaccata
ctgcttgatgttaccagctccaagagcatctgcaaagcagtggaatgggtgaaagctgaa
gtgggtcgaaaaggactctttggtctggtgaacaatgcaggaataggcagttctattggc
cccacagaatggatgactgtggaagactaccgcaaagtcatggctgttaacacctttgga
atgatcgaggtatcgttggccttcctaccattgctcaagcaagcacatggccgagtagtc
aatatgtccagcgtcttggggcggctttcagccaacggtggtggctactgcatttccaaa
tatacagtggaggccttctctgacagcctcagaagggatatgtatcattttggggtaaaa
gtctccattgtggagccaggctttttcaaaacagccatgactgatcttggatcgatagag
gcctctttgcggcaacactgggaccgaatgagccttgaagcccagcggagttatggtgat
cagttctttcacagttacctgaaagtccagaagttcatcatgaacatcatctgtgattct
gatctcagcaaagtgacaaactgcatggagcacgcccttcaagccaagcaccctcgctct
cgttacagtgcaggttgggatgctaaatttctgtggctgccagtttcttatctacctgct
ttcttggtggatattttcctatctatgatcttaccaaagccagctcagcgggtgcgctga

DBGET integrated database retrieval system