KEGG   Python bivittatus (Burmese python): 103065977Help
Entry
103065977         CDS       T03091                                 

Gene name
NDUFS3
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2 1.6.99.3]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00190  Oxidative phosphorylation
pbi01100  Metabolic pathways
Module
pbi_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103065977 (NDUFS3)
Enzymes [BR:pbi01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     103065977 (NDUFS3)
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     103065977 (NDUFS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_30kDa
Motif
Other DBs
NCBI-GeneID: 103065977
NCBI-ProteinID: XP_007431563
Position
Unknown
AA seq 258 aa AA seqDB search
MLAAFRGLARVGLRAAGRPAMILQTRFQGNDAAETKFTIRPKDEITQKQLSGFGEYVAEI
LPKYVQQVQITCFNELEILIHPDGILPVISFLKDHTNAQFKSLADLTAVDVPTRQYRFEI
VYNLLSLPYNSRIRVKTYTDELTPIESIVPIHEGANWYEREVWDMFGVFFANHPDLRRIL
TDYGFEGHPFRKDFPLSGYVEVRYDDEVKRVVAEPLELSQEFRKFDLNSPWEAFPAYRQA
PQTLKIEAGEKKGDGKQQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgctggcggcattccgagggctagcccgggtcgggctgagagctgctgggcgccctgca
atgatattgcagactcggtttcaaggaaacgatgctgctgaaaccaagtttaccattaga
ccaaaggatgaaataacacaaaaacagctgtctggctttggagaatatgttgctgagatt
ctgcctaagtatgttcaacaagtccagataacatgtttcaatgagctggaaattttaatt
catccagatggaatccttcctgtgatatcttttctaaaagatcacacaaatgcccagttc
aaatccttggctgatctgacagcagtcgatgttccaactcgacaataccgttttgaaatt
gtctacaatttgttatctctgccctacaattcccgaattcgcgtgaaaacctatactgat
gaattgacacccattgagtctatagtgccaatacatgaaggggcaaattggtatgaaaga
gaggtctgggatatgtttggagtattctttgccaaccacccagatctgaggcgaatcctt
acagattatggttttgaaggtcatcctttcaggaaagattttcccctctctggatatgtg
gaggtcaggtatgatgatgaggtgaagcgagtggtcgcagagccactggaattgtctcag
gagttccgcaaatttgatttgaacagcccttgggaggccttccctgcttatcgccaggct
ccccaaaccttgaagatagaagcaggagagaagaaaggagatgggaaacagcagtga

DBGET integrated database retrieval system