KEGG   Python bivittatus (Burmese python): 103066807Help
Entry
103066807         CDS       T03091                                 

Definition
(RefSeq) cytosolic phospholipase A2 epsilon-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00564  Glycerophospholipid metabolism
pbi00565  Ether lipid metabolism
pbi00590  Arachidonic acid metabolism
pbi00591  Linoleic acid metabolism
pbi00592  alpha-Linolenic acid metabolism
pbi01100  Metabolic pathways
pbi04010  MAPK signaling pathway
pbi04217  Necroptosis
pbi04270  Vascular smooth muscle contraction
pbi04370  VEGF signaling pathway
pbi04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103066807
   00565 Ether lipid metabolism
    103066807
   00590 Arachidonic acid metabolism
    103066807
   00591 Linoleic acid metabolism
    103066807
   00592 alpha-Linolenic acid metabolism
    103066807
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103066807
   04370 VEGF signaling pathway
    103066807
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103066807
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103066807
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103066807
Enzymes [BR:pbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     103066807
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B
Motif
Other DBs
NCBI-GeneID: 103066807
NCBI-ProteinID: XP_025032436
Position
Unknown
AA seq 493 aa AA seqDB search
MTTAGGVRSMTAMYGSLLGLQKLNLLHCISYITGLSGTTWTMINLYKDPYWSHNNLEDVI
TDVRKQVVKNKLCCFTGERLKYYEKEIQNRHVEGHTLSFTDLWGLILESMLHDEPDPHKL
SDQRQAINRGQNPLPIYLALNVKKKYSTLDFKEWVEFTPYEVGFLKYGGFINAEDFGSEF
YTGHLMKKIPESRLCFMQGMWSNIYSQSMLDALYLAECPEDFWHKWTRPRIYDIEEDIPP
RLPKRPYVQPTRLFIPSGSVTNVLRDVITLRPVVSQFHNFMKGLQLNNKYLENNRFSTWK
DTVLDSSANQLTMSEEHLELVDTAFFINTSCPPLLRPERQVDIIIHLNYSGGSQTLPLDL
STTYYQEQGIPYPKTVITEEDRKHLKECYTFDDAESPKAPILLYFPLVCDTFQKYKAPGV
ERGPSEMEDGHVDVTSTVFSPYATGMVQYSEENFNKLLNLTTYNILNNEHSILQALRTVI
ERKKQQKSFCSSF
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgactacagcaggtggagtaagatcaatgacagccatgtatgggagcctattaggtctc
cagaagctcaatctcttacactgtatttcatacatcactggtttatctggcacaacatgg
actatgataaatttatacaaagatccatattggtcacacaataatctggaagatgtgatc
actgatgttcggaaacaggtggtgaaaaataaactgtgctgttttactggagagcgcttg
aaatattatgaaaaggaaatacagaacaggcatgttgagggtcacacgttatcattcaca
gatctctggggactaattcttgaatctatgcttcacgatgagccagatccccataagctc
tcagatcaacgacaggcaataaatcgaggtcaaaaccctcttcctatctaccttgctctt
aatgtcaagaaaaaatatagcactctagattttaaagaatgggtggaattcacaccatat
gaagtgggcttcctgaaatatggagggttcattaatgcagaagattttggaagtgagttc
tacacgggtcacttgatgaagaagattccagaatctcggctttgtttcatgcaaggcatg
tggagtaatatctattcccagagtatgctggatgctttatatttagcagaatgtccagaa
gacttttggcacaagtggacaagacctagaatctatgatattgaagaagatattccccct
cggcttcccaagaggccatatgtgcagccaacacgtctttttatccctagtggttctgtc
acaaatgtgcttagagatgttataaccttgcgtccagttgtttcacagtttcacaatttt
atgaaaggcctgcagttgaacaacaaatacttagagaataacaggttttctacctggaaa
gatactgtactagattctagcgccaatcaactgaccatgtctgaagaacatttggaactt
gtagacacagctttctttatcaataccagctgcccacctcttttaaggccagaaagacaa
gtggacattattatacatttaaattacagtggaggatcacagacattgccactggactta
agcacaacgtactatcaggagcagggcatcccataccctaagactgttatcacagaagaa
gacaggaagcatctcaaggaatgttatacctttgatgatgcagagagtccaaaggctcct
atactgctgtatttcccacttgtatgtgacaccttccaaaaatacaaagcacctggtgtg
gaacgtggtccaagtgagatggaggatggccatgttgatgtcaccagcactgttttttct
ccatatgctactggcatggtgcaatactcagaggagaacttcaacaagctgctaaatttg
accacctataacattctgaataatgaacattcgattcttcaggctttacggacagtaatc
gaaaggaagaagcagcagaagtctttctgttcctctttttaa

DBGET integrated database retrieval system