KEGG   Python bivittatus (Burmese python): 103067634Help
Entry
103067634         CDS       T03091                                 

Definition
(RefSeq) stromelysin-1
  KO
K01394  matrix metalloproteinase-3 (stromelysin 1, progelatinase) [EC:3.4.24.17]
Organism
pbi  Python bivittatus (Burmese python)
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pbi01002]
    103067634
Enzymes [BR:pbi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.17  stromelysin 1
     103067634
Peptidases [BR:pbi01002]
 Metallo Peptidases
  Family M10
   103067634
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 DUF4953 Reprolysin_3 Reprolysin_5 Reprolysin_4 Peptidase_M43 PT
Motif
Other DBs
NCBI-GeneID: 103067634
NCBI-ProteinID: XP_007434799
Position
Unknown
AA seq 447 aa AA seqDB search
MELAEKYIQHYYPESESTLVIKTKVKNGITPEKIRQMQEFLKLKVTGKLDTNTLDAMKRP
RCGIVDIGEYNTFPGSPKWGKKDLTYSILNYTPDMEPRHVDYAIEKAWKVWSDVTPLTFT
RVYGKPADIEISFVTGAHGDGFPFDGEGGNLAHAFSPAFGGNAHFDEDEFWAKDLKGTNL
FLVAAHEFGHSLGLQHSSNLGALMFPIYQPMDPRALRLHTDDIEGIQSLYGAPDDYDDYD
NTSVNPTDAPTEVPSTEPCHPNQAFDAVTSLRGETMFFKDSYFWRKNPRRNEIEKDPISA
FWPSLSGGVDAAYENKDKDIVFLFKGHKYWSTRGNIIEHGFPKSIQNLGFPHTVKKVDAA
AYDRSSKKIYFISGDNYWRYDDKKNSMEQGYPRKITADFHNIGSKVDAAFIDNGHIYLFS
GSKQYEFESETKRFLGLKKSNSWLGCQ
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggaacttgctgagaaatacatacaacattattatcctgaatcagaatcaacacttgtg
ataaaaaccaaagtcaagaatggcattactccagaaaaaatacggcagatgcaggaattc
ttgaagctgaaagtgactggcaaattagatacaaacactttggatgctatgaagagaccc
aggtgtggcattgtcgatataggggaatacaacacttttcctggttcacctaaatgggga
aagaaagacctgacatacagtattctcaactatacacctgacatggaacccagacatgta
gactatgcgattgagaaagcttggaaagtgtggagtgatgtgacccccttgaccttcacc
agggtttatgggaaacctgccgatattgaaatctcttttgttactggagcacatggagat
ggttttccttttgatggagaaggtggaaatttggcccatgccttttcacctgcttttggt
ggaaatgctcattttgatgaggatgaattctgggcaaaggatttgaaaggaacaaacctt
tttcttgtggctgctcatgagtttggccactcattagggcttcaacattccagcaatctg
ggggctctgatgtttcccatctaccaaccaatggatcccagagccctaagacttcacact
gatgacattgaaggcatccagagcctttatggagcccctgatgattatgatgattatgac
aacacatcagtaaaccctacagatgccccaacagaagtgccatcaacagagccttgccac
cccaaccaagcttttgatgctgttacttctctcagaggggaaaccatgttctttaaagac
agttacttctggcgaaagaatccccgcagaaacgagattgagaaagatcctatttctgct
ttctggccatctttgagcggcggtgtagatgctgcatatgaaaacaaagacaaggacatc
gtcttccttttcaagggacataagtattggtctaccaggggaaatattatagagcacggt
ttcccaaagagcatccagaatctgggcttcccacatacagttaaaaaagttgatgcagca
gcttatgacagaagttcaaagaaaatatacttcatttcaggcgacaattattggaggtat
gatgacaagaagaactccatggagcaagggtatccaaggaagataacagctgacttccat
aacattggctccaaggtggatgctgcttttatagataatggacatatctatttattcagt
ggctcaaagcagtatgaatttgagtctgaaaccaaaagatttctgggcctaaagaagagc
aacagctggttgggttgccagtga

DBGET integrated database retrieval system