KEGG   Python bivittatus (Burmese python): 103067978Help
Entry
103067978         CDS       T03091                                 

Definition
(RefSeq) mitogen-activated protein kinase 15-like isoform X2
  KO
K19603  mitogen-activated protein kinase 15 [EC:2.7.11.24]
Organism
pbi  Python bivittatus (Burmese python)
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pbi01001]
    103067978
Enzymes [BR:pbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103067978
Protein kinases [BR:pbi01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103067978
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 103067978
NCBI-ProteinID: XP_007444556
Position
Unknown
AA seq 145 aa AA seqDB search
MAMGPSASRLLQHRRAAGTFGLCDVPKGPGGASQAASPFKPLSLISQAQEAALNQHLMRK
GTIPSKAAGGLNPRNPESHGREAHFCLKPCKKMFQATANVGVAGDPKAHLGSYSQSYGTI
CKSALQSLPVSSTSHPALAPGPQQP
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgggtccatctgcctcacgccttttgcagcaccggagagcagcaggcacattc
ggtctttgtgatgtgccgaaggggcctgggggagcaagccaggctgcatcgcccttcaag
cctctttccttgatcagtcaggcccaggaagcggccctcaaccagcatctgatgagaaag
gggaccattcccagcaaggctgccggcgggctgaatccacggaaccccgaatcccacggc
agggaagcccatttctgtctgaagccgtgcaaaaaaatgttccaggctacagcaaatgtc
ggagtagctggcgaccccaaggcccacctaggcagctactcccagtcctatgggactatc
tgcaagtctgcccttcagagcctgcctgtatccagtacctcccatccagcactagcccct
ggcccccagcagccctga

DBGET integrated database retrieval system