KEGG   Python bivittatus (Burmese python): 103068266Help
Entry
103068266         CDS       T03091                                 

Definition
(RefSeq) glucosylceramidase-like
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00511  Other glycan degradation
pbi00600  Sphingolipid metabolism
pbi01100  Metabolic pathways
pbi04142  Lysosome
Brite
KEGG Orthology (KO) [BR:pbi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    103068266
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    103068266
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    103068266
Enzymes [BR:pbi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     103068266
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C
Motif
Other DBs
NCBI-GeneID: 103068266
NCBI-ProteinID: XP_007435239
Position
Un
AA seq 541 aa AA seqDB search
MYWGALRILASFLFLQLNFAPTGGRPCSPRNFGHGSLVCECGANYCDTLEPVSLPALGSF
VKYESNKAGHRLERSEGPLLDNPPKKDDLVLQLKVFQKYQKIKGFGGALTDSAAINILAL
SAKSQKNLLKSYFSTEGIEYTLVRVPMASCDFSVRLYTYADVEDDFELNNFSLTEEDIKM
KIPILQQAQAVAPRPLSLYASPWTSPVWMKTNGAMTGRGTLKGKPGDRYHKTWANYFIRF
LDEYAKYNLTFWAVTAGNEPTAGDLVFYPFQCLGFSPEHQRDFIAQDLGPALANSTYKGI
ELIILDDQRVMLPYWAEVVLKDPEAAQYINGIGIHWYLDFLAPIDLTLSITHHLFPKYYL
ISTEASTGSYFWEPRVVLGGWDRGSKYSHSILTNLNNYVTGWTDWNLVLDMQGGPNWSKN
YVDSPVIVDKDKDVFYKQPMFYHMAHFSKFLPEGTQRIEIQKNSWSNLEFSAFLRPDGSA
AVVVLNRASKDIPFGISDPGVGYVEAVATADSIQTYLWQRPTEDQEASSLGAKHPEALIR
N
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgtattggggggccctccgaatcctcgcctctttcttgtttctccagctgaattttgcc
ccaacagggggacggccatgttctcccaggaattttgggcacgggtccttggtgtgtgaa
tgtggtgccaattactgtgacacgttggagcccgtctctctcccagctttggggtctttt
gtcaagtacgaaagcaataaagccgggcaccgtttggagcgcagtgaagggcctcttctg
gataatcctcccaagaaagacgacctggttctgcaactcaaggtgttccagaaatatcaa
aaaatcaagggctttggcggggctctcacggattcggctgccattaatatcctggccttg
tccgcaaagagtcaaaaaaacctgctcaaatcttatttctccactgaagggatcgaatat
accttggtccgcgtgcccatggcgagctgcgatttctcagtgaggctctacacatacgca
gacgtggaggacgattttgagctgaacaacttcagtctaactgaggaagatatcaaaatg
aagatccccatccttcaacaagcccaagcagtggctccccgtcctctctccctctatgcc
agtccctggacgtctccagtgtggatgaagaccaacggagccatgactggtcgaggcacc
ctcaaggggaaaccaggggacagatatcacaagacctgggccaactattttatcaggttc
ctcgatgaatacgccaagtataacttgactttctgggctgtgactgctgggaacgaaccc
acggcgggggaccttgtcttctaccccttccaatgccttggcttctcccctgagcaccag
cgggacttcattgcgcaagatttgggccctgctttagccaacagtacatacaagggcatc
gagttgatcattctggatgaccaaagggtgatgcttccttattgggctgaagtggttctc
aaagaccccgaggctgcccaatacatcaacgggatcggaatccactggtatctcgatttc
ttggcacctattgatctgacactctccatcacccaccacctcttcccgaaatattatctc
atctccacagaggcctctaccgggtcctatttttgggagcctcgtgtggtcctgggtggc
tgggatcgtggcagcaagtacagtcacagcatccttacgaacctcaacaactacgtcaca
ggatggacggactggaacctcgttttggatatgcaagggggacccaactggagtaagaat
tacgtggacagccccgtgatcgtagacaaagacaaagacgtcttctacaagcagcccatg
ttctaccatatggcccatttcagcaagttcctccccgagggaactcaacgcattgaaatc
cagaaaaacagttggagtaatttggaattctccgcatttctccgtccagacggctcggcg
gcggtagtggtcttgaacagagcctccaaggatatcccctttgggatctccgatcccggc
gtgggctacgttgaggctgtagcgaccgctgactccatccagacttacctttggcagcgc
cccacggaagaccaggaagcctccagcttgggggccaagcacccagaggcccttatcagg
aattaa

DBGET integrated database retrieval system