KEGG   Python bivittatus (Burmese python): 112540953
Entry
112540953         CDS       T03091                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
pbi  Python bivittatus (Burmese python)
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pbi03036]
    112540953 (ANKRD53)
Chromosome and associated proteins [BR:pbi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    112540953 (ANKRD53)
SSDB
Motif
Pfam: Ank_4 Ank_5 Ank_2 Ank_3 Ank
Other DBs
NCBI-GeneID: 112540953
NCBI-ProteinID: XP_025024105
Position
Unknown
AA seq 542 aa
MAAGASSSTLESNGIVGKGASGRLLIGGPHSLTDSPPAPPVLDLHQLFQKGQQEGLISLS
ALRFSTVKSAKHGGTRYRSREGHYAASVGHTQWLQITVQKAESPTQSDINGFSTLHTAAL
HGRLDCMKMLIEKYNVDVNLASLRGWRPIHLVMGQESKDMAMPCLQYLLSKGADVNVQNQ
TGVSPLHKAASEGRESCLQALIDAGANVHALDNEGQKPIDLCKMWGHRACAKRLSHAMWK
ADKKHRLREMCRLEAIKLECEMKQQEFIENEQRELNFCNILAFENWLMKKGLPLPTRSVL
DFTLFRRQSVMLRKVAGEMASPIPSLSPLFKGGASEVALRVLWKYRRQKPWNLSTNLASE
PATSIYRPPLVRLGVEPEKPTEHDFTSFLFLFKNAFGEPVIQIDNIGKVSSVPELPYEDI
KKSLYPHIKATRLEVPKDFRPMHIFNLKHRRPVGPEHWWTDQMALSLRETLDPIFLSTLK
THFSTYCSSQAPSPRTAAVEEPPPSQADLPAVRRSPLQALSTVPPEQRGHSGKGLPPHLR
SI
NT seq 1629 nt   +upstreamnt  +downstreamnt
atggcggctggagcttcatcttctaccttggaatcaaatgggatcgtcggaaaaggggct
tcaggacgcctcctgattgggggcccccatagcctaaccgactctcctccagccccaccc
gtccttgacctccatcagcttttccaaaaggggcaacaggagggactaatcagcctctct
gccttgcgttttagcaccgtcaagtctgccaagcatggcggcaccaggtaccggtcgcga
gaaggacactacgctgccagcgtgggacacacgcagtggctccagatcaccgtgcagaag
gctgagagcccgacccagtcagatattaacggcttctccacgctgcacactgctgcgctg
cacggacggctggactgcatgaagatgctgattgagaaatacaacgttgatgtcaatctg
gccagcctgcggggctggagacccatccacctggtgatgggccaggagagcaaggacatg
gccatgccgtgcctccagtacttgctcagcaaaggcgcggacgtcaatgtgcagaatcag
actggagtatctccgcttcacaaggctgcaagcgaagggcgcgaatcttgtctccaagct
ctgattgatgctggggctaacgtccatgccctggacaacgagggacagaagcccattgat
ctgtgcaaaatgtggggccacagggcctgtgctaaacgtctctcccacgccatgtggaag
gcagacaagaagcacaggctgcgggagatgtgcagactggaggccattaaactggagtgt
gagatgaagcagcaggaattcattgaaaatgaacagagggagctgaatttctgcaacatc
ttggcgtttgaaaattggctcatgaagaagggcctgccgttgcccactagaagcgtccta
gactttacactctttcggcgtcagtcggtgatgctccgcaaggtggctggggagatggcc
agcccgatcccctccctcagccccctgttcaaggggggggcctcagaggtggccctcaga
gtgctctggaagtaccggcgccagaagccatggaacctcagcaccaacctggcctcagag
cccgccacctccatctaccggccaccgctcgtccggctgggtgtggagccagagaagccc
acggagcacgacttcacctccttcttgttcctcttcaagaacgcttttggggagcccgtg
atccagatcgacaacattggcaaggtgagctccgtccctgagctgccctacgaggacatt
aagaagagcctctacccccacatcaaggccacccgcctggaggtccccaaggatttccgg
ccaatgcacatctttaacctgaagcaccggcgtcccgtgggcccggagcactggtggaca
gaccagatggccctgagcttgcgggagaccctggaccccatcttcctgagcacgctgaag
acccacttctccacctactgcagctctcaagctccaagtccaagaacggccgcagtggaa
gagcctcccccgtcccaagcagatctgccagctgtgaggaggagccccctgcaggccctt
tccactgtgcccccagagcaaaggggacacagcggaaagggattgcccccccacctcaga
agtatttga

DBGET integrated database retrieval system