KEGG   Paenibacillus beijingensis: VN24_02475Help
Entry
VN24_02475        CDS       T03802                                 

Definition
(GenBank) sugar dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
pbj  Paenibacillus beijingensis
Pathway
pbj00030  Pentose phosphate pathway
pbj01100  Metabolic pathways
pbj01120  Microbial metabolism in diverse environments
pbj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pbj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VN24_02475
Enzymes [BR:pbj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     VN24_02475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR 3Beta_HSD Epimerase THF_DHG_CYH_C
Motif
Other DBs
NCBI-ProteinID: AJY73703
UniProt: A0A0D5NFM5
Position
539455..540240
Genome map
AA seq 261 aa AA seqDB search
MYSDLENKTVVITGAATGIGKAIAVRFGREKANVVLNYFDEKQEPQRIVDEIREAGGRAV
AIQGDVTKEEDVKALIEGGVKHFGSVDVMINNAGIENEVPSHELSLEDWNRVISTNLTGA
FLGSREAIKHMLETGKKGSVINMSSVHEVIPWPHFVHYASSKGGIKMLTQTLALEYAPKG
IRVNSIGPGAIDTPINAEKFADPVLKKGVTDLVPMGYIGKPEEVAACAVWLASSEASYVT
GITLFVDGGMTKYPEFQAGRG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtacagtgatctggagaacaaaacggtcgttattaccggcgccgctaccggcatcggc
aaagcaatcgccgtccgtttcgggcgcgagaaggccaatgtcgtcctaaactatttcgat
gaaaaacaggagccccagcgaattgtagacgaaatacgcgaagccggcggaagagcggtg
gccattcagggggacgtgacaaaagaagaagacgtcaaagctctcattgagggaggcgtc
aagcactttggttccgtcgacgtgatgatcaacaacgcgggcatcgaaaatgaagtgcct
tcccatgaattgtcgctggaggactggaaccgggtcatctccaccaacctgaccggtgca
tttctcggttcccgggaagcgattaaacatatgctcgagacgggaaagaaagggtccgtt
attaacatgtccagcgtccatgaagtgattccgtggcctcatttcgttcattacgcatca
agcaagggcggcatcaaaatgctgacccaaacgttggcgctcgaatatgccccgaaaggg
atccgggtcaactctatcggtcccggcgcgatcgatacgccgatcaatgctgaaaaattt
gcggatccggtgctgaaaaaaggcgtcaccgatctcgttccgatgggatatatcggcaaa
ccggaggaagtggcggcatgcgccgtatggctcgcttcgtcggaagcgtcctacgtgacc
ggcattacgctgttcgtggacggaggcatgacaaaataccccgaatttcaagccggacgg
gggtaa

DBGET integrated database retrieval system