KEGG   Paenibacillus beijingensis: VN24_09035Help
Entry
VN24_09035        CDS       T03802                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pbj  Paenibacillus beijingensis
Pathway
pbj00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pbj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    VN24_09035
Enzymes [BR:pbj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     VN24_09035
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     VN24_09035
    1.1.1.-  
     VN24_09035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc TrkA_N LpxI_N Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AJY74702
UniProt: A0A0D5NIA7
Position
2033660..2034712
Genome map
AA seq 350 aa AA seqDB search
MKALRWHDVKDLRVETVEEPVATKGKVKIKVEWCGICGSDLHEYVAGPIFIPKEAPHPLS
GEQAPIVMGHEFSGRVVEVGEGVTKVKVNDRVVVEPILACGECAACRKGMYNLCEKMGFH
GLAGGGGGFSEFTVVSERMVHLLPEELSYEQGALVEPSAVALYAVRQSKLKVGDKAVVFG
AGPIGLLVIEALRAAGASEIYAVELSEERKAKAAELGAIVLDPTKVGNVVDEIRTLTGGG
ADVTFEVTGIGPVLKQSIDATSLEGETIIVSIWEKEASLQPNTLVLPQKSVKGIIAYRDV
FPAVISLMKQGYFSADKLVTKRIHLEEAVSEGFEALLKEKNQVKILVKAE
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactgcgatggcatgatgtaaaagacctgcgcgtcgaaacggtcgaagaacct
gtcgcgacaaaaggcaaagtgaaaattaaggtggaatggtgcggcatctgcggaagcgat
ctgcatgaatatgtcgccggcccgattttcatcccgaaggaggcgccccatcctctgagc
ggggaacaagcgccgattgtgatgggacacgaattttccggccgcgtcgtcgaagtcggc
gaaggggtgacgaaggtcaaagtgaacgaccgcgtcgtcgtggaaccgatactggcatgc
ggagaatgcgccgcctgtcgcaaaggaatgtacaatctgtgtgaaaaaatgggcttccac
ggccttgccggcggcggcggcggcttctcggagtttacggtcgtgagcgagcgcatggtg
cacctgctgccggaggaactgtcctacgagcagggcgcgctcgtcgagccttcggccgtc
gccttgtacgccgtccgccaaagcaagctgaaagtcggcgacaaggcggtcgtgttcggc
gccggcccgatcggcctgctcgtcattgaagcgctgcgggctgccggcgcttcggagatc
tatgccgtggagctgtccgaagaacggaaagcgaaggcggcggagctcggcgccatcgtc
cttgatccgacgaaggtcggcaatgtggtggatgaaatccggacgctgaccggcggcgga
gcggacgtcacgttcgaggtgaccggcatcggcccggtgctgaagcaaagcatcgacgcc
accagcctcgaaggcgaaacgattattgtgagcatctgggagaaggaagcttccctgcag
ccgaacacgctcgtactgccgcaaaaatcggtgaagggcatcattgcgtaccgcgacgtg
ttcccggccgttatttcgctcatgaagcagggctacttctcggcggacaagctcgttacg
aagcgcattcacctggaagaagccgtctcggaaggcttcgaagcgctgctgaaagaaaaa
aatcaggtgaaaattctcgtcaaagccgaataa

DBGET integrated database retrieval system