KEGG   Paenibacillus beijingensis: VN24_10645Help
Entry
VN24_10645        CDS       T03802                                 

Definition
(GenBank) dienelactone hydrolase
  KO
K01633  7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81]
Organism
pbj  Paenibacillus beijingensis
Pathway
pbj00790  Folate biosynthesis
pbj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VN24_10645
Enzymes [BR:pbj01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.81  7,8-dihydroneopterin oxygenase
     VN24_10645
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     VN24_10645
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.99  Acting on other compounds
    5.1.99.8  7,8-dihydroneopterin epimerase
     VN24_10645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FolB
Motif
Other DBs
NCBI-ProteinID: AJY74967
UniProt: A0A0D5NIZ8
Position
2367052..2367438
Genome map
AA seq 128 aa AA seqDB search
MDTMTLNGMKFYGYHGVFAEENKLGQQFWVDLVLRMDLEKAAQSDDLNESINYAELHALT
KKIVEGPPCKLIEALAGRIASSLLQTYTGIHELTVRVTKPNPPFDIHFDGVVVELRRKRD
EHGQIVPV
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggatacgatgacgctgaacgggatgaagttttacggatatcatggcgtttttgccgaa
gaaaacaagctgggccagcagttttgggtcgatctggtgctgcggatggatttggagaaa
gcggcgcaaagcgacgatttgaacgagtcgatcaattacgccgagctgcatgcgttgacg
aagaaaattgtcgaaggaccgccgtgcaagctgatcgaagctttggccgggcgtattgca
tcctctttgcttcagacttatactggaatacatgaattgacggttcgcgttacgaagccg
aaccccccgttcgacattcattttgacggggttgtcgtcgaattgcgcagaaagcgggat
gagcatggacaaatcgttcccgtttaa

DBGET integrated database retrieval system