KEGG   Paenibacillus beijingensis: VN24_13810Help
Entry
VN24_13810        CDS       T03802                                 

Definition
(GenBank) GTP cyclohydrolase
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
pbj  Paenibacillus beijingensis
Pathway
pbj00740  Riboflavin metabolism
pbj00790  Folate biosynthesis
pbj01100  Metabolic pathways
pbj01110  Biosynthesis of secondary metabolites
pbj02024  Quorum sensing
Module
pbj_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:pbj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    VN24_13810
   00790 Folate biosynthesis
    VN24_13810
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    VN24_13810
Enzymes [BR:pbj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     VN24_13810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AJY75447
UniProt: A0A0D5NKB0
Position
3042507..3043226
Genome map
AA seq 239 aa AA seqDB search
MADGPAGTTNIVVGPIKLPVDLDGQTVTFNWYSWLSVSETEAAAIRSEGTESLIRRLPSF
QLADKQQSSVLVYGDFEHAEQALIRMHSICHTGDIFGSKRCDCGFQLRQSMKMIIDTGAG
ALFYLANHEGRGIGLFSKAMAYLLQENGYDTVDANLKLGFADDARDYGEAISVLRLLRTK
AVTLITNNPKKLDALREAGLNVSGRIPLWGSVSSHNEKYLQTKIARSGHLGSFRETLIQ
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggctgacggcccggccggcacgacgaatattgtagtcggccccatcaaactgccggtc
gatctcgacgggcaaacggtcacgttcaattggtactcctggctatcggtatcggagacc
gaagcagctgctatacgaagcgaggggacggagtcgctgatccggcggctgccatccttt
caacttgccgacaagcagcagtcaagcgtgctcgtatacggcgatttcgagcatgcggag
caggcgctgatccggatgcacagcatttgccatacgggcgatattttcggaagcaaacgc
tgcgattgcggtttccagctgcggcaatcaatgaagatgatcattgataccggcgcgggc
gcattgttctatttggccaatcacgagggacggggcattgggctgttcagcaaggcgatg
gcgtacctgctgcaggagaacggatacgataccgttgatgccaacctgaaactcggcttt
gccgacgacgcgagagattacggcgaagcgatcagcgtgctgcgtctgctgcgtaccaag
gcggtcacgctcattacgaacaacccgaaaaagctggatgcgctgcgcgaagcgggcctg
aacgtcagcggacggattccgctgtggggaagcgtttcttctcataatgaaaaatattta
cagaccaaaatcgcgcgttccggccatcttggatccttccgggaaacgcttatccaataa

DBGET integrated database retrieval system