KEGG   Paenibacillus beijingensis: VN24_14405Help
Entry
VN24_14405        CDS       T03802                                 

Definition
(GenBank) NADPH--cytochrome P450 reductase
  KO
K14338  cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
pbj  Paenibacillus beijingensis
Pathway
pbj00071  Fatty acid degradation
pbj00380  Tryptophan metabolism
pbj00627  Aminobenzoate degradation
pbj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pbj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VN24_14405
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    VN24_14405
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    VN24_14405
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:pbj00199]
    VN24_14405
Enzymes [BR:pbj01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     VN24_14405
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     VN24_14405
Cytochrome P450 [BR:pbj00199]
 Cytochrome P450, bacteria type
  CYP102 family
   VN24_14405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450 FAD_binding_1 Flavodoxin_1 NAD_binding_1 Flavodoxin_5 DUF3212
Motif
Other DBs
NCBI-ProteinID: AJY75535
UniProt: A0A0D5NK70
Position
3184781..3187960
Genome map
AA seq 1059 aa AA seqDB search
MSETITVPLPKMFGPLGNLPLLDKETPMQSIAKIADELGPIFRLELPGRSDLWIWGHELV
KDACDESRFDKYLPVPLQKLRPIGGDGLFTSWTDEPNWKKAHNILLPSFSQRAMQGYHAM
MADIALQLIQKWSRLNPDESIDVPEDMTRLTLDTIGLCGFGYRFNSYYRDNPHPFIVNMV
RALTEGMEQSQRLSLQDKLMVMTKRQFKLDIQSMFSLVDKIIAERKESGSQDAQDLLSRM
LRSKDPETGETLSEENIRYQIITFLIAGHETTSGLLSFSLYFLLKNPDKLRKAYEEVDRV
LTEPVPTYNQVRSLKYIRMILDESLRLWPTAPIFSLYAKEDTMLGGVYSMKKGEGVNVLL
PKLHRDTAVWGDDAEAFRPERFENPSLIPQHAYKPFGNGMRACIGMQFSLHEATMVLGMI
LRQFEIIDHTNYQLKVKETLTLKPQGLTMRVRPRAGQPIAAVALKEEAPDKKMTQPVAAS
SAVQSHNTPLLVLYGSNLGTAEGIARELADAARYQGFRTEVAPLDERIGKLPTEGAVLIV
AASYNGKPADNARGFVQWLEQAEPDAVKGVRYAVFGCGDRNWAVSYQQVPRLIDRQLDAK
GASRLTGIGEGDASDDFEKQLDDWRNRMWPDMMGAFDLTVNENAKQEPSTLTVRLVSGPV
DTPLAESYDAFFASVLDNRELQSAESGRSTRHLEFALPEGAAYQEGDHLGVFPHNHPDLV
ERVLRRYELNGSDYFILSASTSSAAHLPLDRPVNVRVLLSRSVELQEAATRAQLRELASY
TVCPPHKRELEALLQEDAYKTNVLEKRLTMLDLLEQYPACEMPFERFLELLPPLKARYYS
ISSSSRVQPDRASITVGVVSGPARSGRGEYRGVASNYLAGRLTGDSVALFVRRPESGFQL
PDDPMTPIIMVGPGTGIAPFRGFLQARRALVQEGREVGEAHLYFGCRNPHHDYLYQEELA
SFEREGLVTLHTAFSRVEGKEKRYVQHLIRQDAGHLIRLLDQGGRLYICGDGSRMAPDVE
AALRSAYGSVHGGSERDAQLWLDQIRDEGRYAKDVWAGV
NT seq 3180 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaccattactgtaccgctgccgaaaatgttcggtccgctgggcaatttgccg
cttttggacaaagagacccccatgcaatccatcgcaaaaatcgcggatgagctcggcccc
atcttccggttggaattgcccggcagaagcgacctctggatctggggacatgagctggtt
aaggatgcctgcgacgaatcccgcttcgacaagtacttgccggttcccctgcagaagctc
cgccccattggaggagacggccttttcacgagctggaccgatgagccgaactggaaaaag
gcgcacaatattttgctgcccagcttcagccagagagcgatgcaggggtatcacgcgatg
atggcggatatcgccctgcagctgattcaaaagtggtcgcgcctgaacccggatgaaagc
atcgatgtgccggaggatatgacgcgtcttacgctcgacacgatcggattgtgcggtttc
ggctaccggttcaacagctattaccgcgataatccgcatccttttatcgtcaacatggtc
cgcgcccttacagaagggatggagcaaagccagcggctcagcctgcaggacaagctgatg
gtcatgacgaaacgccagttcaagcttgacattcagtcgatgttttcgcttgtggacaaa
attattgccgagcgcaaagaaagcggcagccaggacgcccaggatttgctctcgcggatg
ctccgcagcaaagatcccgagacgggggagacgttaagcgaagaaaatatcaggtaccag
atcattaccttcctcattgccggacatgaaacgaccagcggtctcctctccttctctctc
tacttcctgctcaaaaaccccgacaaactgagaaaagcttacgaagaagtcgatcgcgtt
cttaccgaaccggtcccgacttataaccaggttcgctcattaaagtacattcgcatgatc
ctcgacgaatctttgcgcctgtggccgacggccccgatcttctcgctttatgcgaaagaa
gatacgatgctgggcggtgtctattcgatgaaaaagggagaaggcgtcaatgtgctgctg
cccaaactgcaccgcgatactgccgtttggggagacgacgccgaagctttccggccggaa
cggttcgagaatccaagcctgatcccccagcatgcctataaaccgttcggcaacggcatg
agagcatgtatcgggatgcagttttcgcttcatgaagcgacgatggtgcttggcatgatt
ctcagacagttcgaaattatcgaccacacgaactaccagctcaaagtgaaggaaacgttg
acgctcaaaccccaagggttaacgatgcgtgtccgtcctcgcgcaggccagccgattgcg
gccgtcgctctcaaagaggaggctccggacaagaagatgacccagccggtggcggcctcc
tctgccgttcagtctcacaataccccgctgctggtgctctacggttccaatctcggcacg
gcggaagggatcgcgcgggagctggccgatgccgcccgttaccaaggcttcaggaccgaa
gttgcgccgcttgatgagcgcatcgggaagctccccacagagggcgcggtgcttattgtc
gccgcttcctataacggcaaaccggcggataacgcgcgcggcttcgtccagtggctcgag
caggcggagccggatgcggtcaaaggggttcgatacgccgtttttggttgcggagaccgc
aactgggccgtcagctaccagcaggtaccgcgcttgatcgaccggcagcttgacgccaaa
ggagcgtcgcgccttaccgggatcggcgaaggcgatgcaagcgacgatttcgagaagcag
cttgacgattggcggaatcgtatgtggccggatatgatgggcgcttttgatttaacggtt
aacgaaaatgcgaagcaggaacccagtacgctcaccgtacggttagtgagcgggcctgtc
gatactccgcttgcagaaagctatgacgccttttttgcatcggtcctggacaacagggag
cttcaatcggcggaaagcggccgcagcacgcgccaccttgagttcgcgctgcctgaagga
gccgcctatcaggaaggagatcacctgggcgtcttcccgcacaatcatccggaccttgtg
gagcgcgtcctgcgccgctacgaactgaacggcagcgactatttcatcttgagcgcaagc
accagcagcgccgcacatcttcctttggaccgcccggtcaatgtacgcgtgctgctcagc
cgcagcgtggagctgcaggaggcggcaacccgggcgcagctgcgggagcttgcgtcctat
acggtctgtccgccgcataagcgggagctggaggcgcttctgcaagaagacgcctataaa
actaacgtgctcgagaaacggcttacgatgctggatttgcttgagcaatatccggcctgc
gaaatgccgttcgaacggtttctggagctgctcccgccattaaaagcccgttattattcc
atttcaagctcttcccgtgtgcagccggaccgcgcaagcattaccgtcggcgtcgtaagc
ggcccggccaggagcgggcgcggcgaatatcgcggcgtcgcttcgaattacctggccgga
cgcctgaccggcgattcggttgccctctttgtccgccggccggagtcgggattccagctt
ccggacgatccgatgacgcctattattatggtggggccgggcactgggattgcccctttc
cgcggttttctgcaggcccgccgcgcgctcgttcaggaaggacgggaagtgggggaggcg
catctgtacttcggatgccgcaatccgcaccacgattatttgtaccaggaagagctcgca
agcttcgagcgggaaggtctggtcacccttcatacggcgttctcgcgcgttgaaggaaaa
gaaaagcgctatgtccagcatctcatccggcaggatgccggtcatttgatccgccttctg
gatcagggcggccgcttgtatatttgcggcgacggaagccggatggcgccggacgtcgag
gcggcgcttcggtccgcgtacggcagcgttcatggcggaagcgaacgggatgcgcagtta
tggctggaccaaatccgcgacgagggcagatacgccaaggacgtctgggcaggagtttaa

DBGET integrated database retrieval system