KEGG   Paenibacillus beijingensis: VN24_17680Help
Entry
VN24_17680        CDS       T03802                                 

Definition
(GenBank) hypothetical protein
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
pbj  Paenibacillus beijingensis
Brite
KEGG Orthology (KO) [BR:pbj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pbj03009]
    VN24_17680
Enzymes [BR:pbj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     VN24_17680
Ribosome biogenesis [BR:pbj03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    VN24_17680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AJY76051
UniProt: A0A0D5NLA3
Position
3918517..3919668
Genome map
AA seq 383 aa AA seqDB search
MFDYSQALRKGEWLEIPLSALALTGSESKGAAVPAGLSNPDEGAVQSEPESRPDEEVGPS
EAGSDEREGAAPLGAGSHPHEVRQRLLALSLFPAKWINRLFSVGGIRLEGETVRLLAFPA
ANPAADPLYRQAAEALRELKRREEKPGSNGRPDKSGSLKAAGAAIVPILYQDDYCMVLDK
PAGMPVHASFPGQRGTLDEAAALHCLLAGDPLPVRHVHRLDEDTSGPVLYTKNDLSQLRL
DEEMRHKRIDRQYIALVEGIPARSRGTVRAPIGKDRHHRSRRRVHPGGDEAVTHYEVAER
FAAAALLRLRLETGRTHQIRVHMSHLGHPLIGDTLYGGSAGLLGHQALHGEKIIFTHPLS
GDRMEIVSPVPEWFEAVRSRLKG
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgtttgattacagccaggcgctccggaaaggggaatggctggaaataccgctttccgcc
ctagcgctaaccggatcggaatcaaaaggagcggcagtgcccgcaggtttaagcaatccg
gacgaaggagcggtccagtctgaacccgaaagccgtccggacgaggaagtcggcccgtcc
gaagccggaagcgatgagcgcgagggagccgctccgcttggggccggaagccacccgcac
gaagtgcggcagaggcttctggccctctctttgtttccggcaaaatggatcaaccgtctg
ttttcggtcggcggcatacgtctggaaggagagacggtgcgcctgctggcgtttccggcg
gcgaatcccgccgccgacccgctgtatcgccaggcagcggaagcgctacgcgaactgaag
cggagggaggagaagccgggcagtaacggccgaccggacaaatccggcagcttgaaagcg
gccggcgccgcaatcgttcccattctgtaccaagacgattactgcatggtactcgataag
ccggccggaatgcccgtgcatgcttcttttcccggacagcggggaacgctggacgaagcg
gcggcgctgcactgcctgcttgcgggtgacccgctgcctgtacggcatgtgcaccggctc
gatgaggatacgtcgggaccggttctttacacgaaaaacgatctttcccagctgcggctc
gatgaagagatgcggcataaacgcattgaccggcagtacatcgcgcttgtggaagggatt
cccgcgcgcagccgggggacggtccgcgctccgatcggcaaggaccggcaccaccgctcg
cgccggcgggtacatccgggtggcgatgaagccgttacccattacgaagtggcggaacgg
tttgccgccgccgctctgctgaggcttcgcctggaaacgggccggacccatcagatccgg
gttcatatgagccatctgggacatcctctgatcggcgatacgctgtacggaggaagcgca
ggtctgctcggacatcaggcgctgcacggcgaaaaaatcattttcacccacccgctctcc
ggtgaccggatggaaatcgtttcacccgtaccggaatggtttgaagcggtccgttcgcgt
ttgaagggttaa

DBGET integrated database retrieval system