KEGG   Paracoccidioides lutzii Pb01: PAAG_00295Help
Entry
PAAG_00295        CDS       T02230                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase
  KO
K11836  ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
pbl  Paracoccidioides lutzii Pb01
Brite
Enzymes [BR:pbl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PAAG_00295
Peptidases [BR:pbl01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PAAG_00295
Ubiquitin system [BR:pbl04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    PAAG_00295
Exosome [BR:pbl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PAAG_00295
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH zf-UBP UBA UCH_1 UBA_4 HEAT_2
Motif
Other DBs
NCBI-GeneID: 9100841
NCBI-ProteinID: XP_015700306
UniProt: C1GP50
Position
Unknown
AA seq 790 aa AA seqDB search
MACIHLDSPELRAPRINQPVYREDCTQCFDSIDDPSGLDVCLFCFNGGCTGDRNHSSIHH
KRSGHPLVLNIKRTRKIVQRDEPPLKMSKLAITAETEEDRYDTTTTVNCHSCQVSDIDKS
AGNLPSVVDGVMKALTFSRQEEVKAWEQEYSPCKHVLSLVQHGSIQENSNDFSKCASCNL
KENLWLCLECGNLGCGRSQFGGVGGNSHGLAHADSSSHGVAVKLGSITPEGSADVFCYKC
NDEIIDPNLATHLAHWGINVAERQKTEQSLVEMQIEQNLKWDFSMTGQDGHESKPLFGKG
LTGLKNLGNSCYISSAVQCLFSLPEFKERYFQSMTEPPPAVAPAEDLETQLRKLSDGIHS
GRYSFPDPDVAISAHSADVVYQKGLAPAMFKHLVGRGHEEFSTMRQQDAFEFLLHLFKLI
TRSKHTDGLQDPVGSFRFALEQRLQCLVCKKVRYTVDEQDNISVPVPARRVKPSNSAVDG
TEDRNSSDKPEFETVTLKECLGIFTGEEIVELTCPACGSNDGFLKRSRFKTFPRNLAINA
RRFSLVNWVPTKLNIPVEVDDKPVDLSSYMSPGFQEGEEQLPDNPPSEPTAFAPNQAALN
QLLAMGFPDVRCKKALHATGNSDAEAAMTWLFAHMEDPDIDVPVELTTSNATSVDHPMDD
PDKIAQLNEMGIDSAKARKALRETDGNVMRAVDWVFSHPDDFGAVETPPGDAASNEPPGS
KYLPAEFQLQSIICHKGASVHAGHYVAFVRKLLPGSETPQWVLFNDEKVVEANDVEEMKQ
FAYVYIFRRL
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atggcttgcattcatcttgattccccagagcttcgtgccccgcggatcaaccaaccagtc
tatcgagaagattgcacgcagtgttttgactcaattgatgacccatctggcttggatgtg
tgtcttttctgtttcaatgggggttgtactggggacagaaatcactctagcatccaccat
aaacggtccggacatccattggtgttgaatatcaagagaaccaggaagatagtacagcga
gatgagcctccccttaagatgtcgaagctagcgatcactgcggaaacagaagaagatcgc
tatgataccaccacaacggtcaactgtcattcttgtcaagttagtgatattgacaagtct
gccggaaatctcccttccgttgttgacggtgtaatgaaggcactcacattttctcgtcag
gaggaagtgaaggcgtgggagcaggaatattccccttgtaagcatgtgctgtcgctggtg
cagcatggctcaatccaggagaattccaatgatttttctaagtgcgcctcgtgcaactta
aaagagaacctatggttgtgcctcgagtgtggtaatcttggatgtggccgaagccagttt
ggcggcgtgggtggtaattcccacggacttgctcatgcggatagttcttcccatggcgtc
gctgtaaagcttggttctattacacccgaaggctctgcggatgttttctgttacaaatgt
aatgacgagataatcgatccaaatcttgctacacaccttgcgcactgggggataaacgtt
gctgagcgacaaaaaaccgagcaaagccttgttgaaatgcagattgaacaaaatcttaaa
tgggatttttcaatgactggtcaggatgggcatgagtcgaaacccctttttggaaaggga
cttactggactcaagaatttaggaaacagctgttatatttccagcgctgttcagtgtctt
ttctcgttacctgagtttaaggagcggtacttccaatccatgacagaaccaccgcctgcc
gttgcacctgccgaggacctagaaactcaattgcgaaaactcagtgatggtattcactct
ggccgctattcatttcccgacccagatgttgcgatttcggctcattctgcagacgttgtc
tatcaaaaaggacttgcacctgcaatgttcaaacatttggttggccgtggtcacgaggaa
ttttcaactatgcgccagcaagatgcatttgaatttcttctgcatctcttcaaactcatt
actcgttcaaaacacacagatggcctccaagatcccgtgggctcctttcgatttgcactt
gagcagcgcttacaatgcctagtatgcaaaaaggtccgatacacagtagatgaacaggat
aatatatcagtccctgttcccgcacgtcgtgtaaaacctagcaatagtgcagtagatgga
accgaagatcggaattcttcagataaaccagagttcgagacggttactctgaaggagtgc
ttgggcatttttacaggggaagagattgttgaactaacatgtccagcatgtggcagcaat
gatggcttcctcaaacgatcacgctttaagactttcccgaggaatttggctattaacgct
cgccgtttcagtctagtcaactgggtgccaacaaaacttaatatccctgttgaggttgat
gataaaccggtcgacttaagctcgtacatgtcccccgggtttcaggaaggtgaagaacaa
ttgcctgacaatcctccgagtgagccaacggcgtttgctccaaatcaagctgcacttaat
cagctcctagcgatgggtttcccagatgttcggtgcaagaaggctcttcatgcaacggga
aactctgatgcagaggctgccatgacttggttatttgcccatatggaagatccagatatt
gatgttcctgtagaacttaccaccagcaatgctacctctgtcgatcacccaatggatgac
ccagacaaaatcgctcagctaaatgaaatgggaattgactctgccaaggctcgtaaggct
cttagagaaacggatgggaatgttatgagagctgtcgattgggttttcagccaccctgat
gattttggggcggttgagaccccacctggtgacgcagcctccaatgaacctccagggtct
aaatatttgccagctgagtttcagttacaatccattatctgccataaaggagcttcagtt
catgccggacactatgttgcctttgtacgaaagctgcttccgggatcggaaacgccacag
tgggttcttttcaacgatgagaaggttgttgaggcaaacgacgttgaggagatgaagcag
ttcgcatatgtctacattttcagacgattatag

DBGET integrated database retrieval system