KEGG   Paracoccidioides lutzii Pb01: PAAG_00316Help
Entry
PAAG_00316        CDS       T02230                                 

Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
pbl00230  Purine metabolism
pbl01100  Metabolic pathways
Module
pbl_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PAAG_00316
Enzymes [BR:pbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PAAG_00316
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_33 MMR_HSR1 AAA_22 AAA_28 ABC_tran RsgA_GTPase AAA AAA_18 Rad17 RNA_helicase AAA_24 AAA_29 AAA_14 AAA_5 NACHT DUF2075 AAA_30 NTPase_1 ATPase_2 T2SSE cobW Viral_helicase1 Adeno_IVa2 Septin AAA_19
Motif
Other DBs
NCBI-GeneID: 9100862
NCBI-ProteinID: XP_002797777
UniProt: C1GP71
Position
Unknown
AA seq 203 aa AA seqDB search
MEETPTAAVRKFRPVVISGPSGTGKSTLIKRLFADYPDTFALSVSHTTRSPRPGEQDGRE
YYFTTKDAFKSLIDERGFIEWAQFSGNYYGTSTKAVKDVAEKKRICVLDIEMEGVKQVKR
TDLNARFLFVAPPSLKVLEQRLRGRGTETEESLQARLEQARKELEFAKEPGVHDLVIVND
ELEAAYGALREWVVDGGRFGDGD
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaccccaacagcagcagtacgcaagttccgccccgtagtaatatcaggaccg
tccggcacgggcaaatcaactctgataaaaagactcttcgctgattacccagacacattt
gccctttcagtttctcatacaacccgctctccacgccccggcgaacaagatggccgcgaa
tactacttcacaacaaaagatgccttcaaatccctcatcgacgaaaggggctttatagaa
tgggcccagttcagcgggaactactacggtaccagcactaaggccgtaaaagacgtagcg
gagaagaagcgcatttgcgtcctggatattgagatggagggtgtcaaacaagtaaaacgc
acagatctaaacgcgcgcttcctcttcgttgcgccgccctcgctgaaggtactggagcag
cgcctccgtggccgcgggacggagacggaggagagtcttcaggcgcgcctggagcaggcg
cggaaggagctggagttcgcgaaagagccgggcgttcatgatttagttattgttaatgat
gagttggaggccgcatatggggcgttgagggagtgggtggttgatggggggaggtttggg
gatggggattga

DBGET integrated database retrieval system