KEGG   Paracoccidioides lutzii Pb01: PAAG_00417Help
Entry
PAAG_00417        CDS       T02230                                 

Definition
(RefSeq) succinyl-CoA ligase subunit alpha
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
pbl00020  Citrate cycle (TCA cycle)
pbl00640  Propanoate metabolism
pbl01100  Metabolic pathways
pbl01110  Biosynthesis of secondary metabolites
pbl01130  Biosynthesis of antibiotics
pbl01200  Carbon metabolism
Module
pbl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pbl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pbl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PAAG_00417
   00640 Propanoate metabolism
    PAAG_00417
Enzymes [BR:pbl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     PAAG_00417
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PAAG_00417
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 9101328
NCBI-ProteinID: XP_002797878
UniProt: C1GPH2
Position
Unknown
AA seq 331 aa AA seqDB search
MQVFRRSTASALQNALLCQRRGLITSTAGYSSTIDNLRINSDTKVIYQGFTGKQGTFHAQ
QAIEYGTNIVGGTNPKKAGETHLGKPVFRNVEEAMKETGATASAIFVPPPVAASSIEEAI
RAEVPLVVCITEGIPQHDMVRITDILKTQSKTRLVGPNCPGIIAPGQCKIGIMPGFIHQR
GRIGIVSRSGTLTYEAVNQTTQAGLGQSLVIGIGGDPFSGTNFIDCLKIFLKDEETDGII
MIGEIGGSAEEDAAEFLKSENKANKPAVGFIAGISAPPGRRMGHAGAIVSGGKGGADSKI
SALEAAGVIVERSPAALGKTLLAEFVKRDLV
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcttcagacgtagcacggcttctgcactgcagaatgctctcctgtgtcagcgc
cggggtctaattacctcgaccgccggctattcctcgacgatagacaatctgcggatcaat
agcgacacaaaggtcatctaccagggatttactggaaagcagggaacattccacgcccaa
caagcaattgaatacggaaccaacattgttggcggaacaaatcccaaaaaggcgggcgag
acccatcttggaaagcctgtgtttagaaatgtggaagaggctatgaaggaaacgggcgca
acagcctccgccatcttcgtcccacctccagtagctgccagcagtatcgaggaggcaatt
cgggcggaggtgcctctcgtcgtctgcatcacggaaggtataccacaacatgatatggtt
cgcataaccgatatcctgaaaacgcaaagcaagaccagattagtcggccccaattgcccc
ggcattattgctccaggccaatgcaaaatcggcatcatgcccggcttcatccatcaacgc
ggccgcatcggcatcgtctcccgctccggcaccctaacctacgaagccgtcaaccagacc
acccaggctggcttaggccagtccctcgtcatcggaatcggcggtgatcccttctccggc
accaacttcatcgactgcctcaagatattcctcaaggacgaggagacggacggaatcatc
atgattggcgagattggtgggagtgctgaggaggacgcggcggagttccttaagagtgag
aataaggcgaataagcctgctgttgggttcattgcgggtatcagcgctccgcctggtcgg
cggatgggtcatgctggggccattgtgagtggggggaaaggtggagctgattctaagatc
tccgcacttgaggcggcgggggtgattgttgagcgtagtccagctgcgttggggaagacg
ctgctggcggagtttgtgaagagggatcttgtataa

DBGET integrated database retrieval system