KEGG   Paracoccidioides lutzii Pb01: PAAG_01125Help
Entry
PAAG_01125        CDS       T02230                                 

Definition
(RefSeq) thiazole biosynthesis enzyme
  KO
K03146  cysteine-dependent adenosine diphosphate thiazole synthase [EC:2.4.2.60]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
pbl00730  Thiamine metabolism
pbl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    PAAG_01125
Enzymes [BR:pbl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.60  cysteine-dependent adenosine diphosphate thiazole synthase
     PAAG_01125
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thi4 DAO NAD_binding_8 Lycopene_cycl Pyr_redox_2 NAD_binding_9 FAD_binding_3 FAD_binding_2 Pyr_redox_3 Trp_halogenase
Motif
Other DBs
NCBI-GeneID: 9100151
NCBI-ProteinID: XP_002797266
UniProt: C1GRI0
Position
Unknown
AA seq 383 aa AA seqDB search
MALGDCSEIIRLELDLDNTSERIMQSLFSTPVPPPPKNQTPNLIYSYYLKNMSPPAATSD
VVAHSAAAIAKINKGLAINRDPTATGTILDEFAGKWDEFKFGPIRESQVSRAMTRRYFKD
LDTYAESDIVIVGAGSCGLSTAYVLGKARPDLKIAIIEASVSPGGGAWLGGQLFSAMVLR
KPADRFLDDLGIPYEQEPSNPNLVVIEHAALFTSTLLSKVLSFPNIKLFNATCVEDLVTR
PAPLSGDPEGLRIAGVVTNWTLVTLHHDDHSCMDPNTINAPVVISTTGHDGPFGAFCAKR
LVSMSAIEKLGGMRGLDMNSAEEAIVKNTREVVKGLIIGGMELSEIDGWHRMGPIFSAMM
LSGVRAAEVALEIFEERKKECAE
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggctctgggagattgttctgaaattatacggttggaacttgatctggataataccagc
gaaaggatcatgcaatccctcttctccactcctgtccctcccccccccaagaaccaaact
cctaacctgatatatagttactaccttaaaaatatgtctcctccagctgcaacatccgat
gtagtggcgcattccgccgctgctatcgccaaaattaacaagggactcgcgatcaataga
gaccctacagctaccggcactatcctagatgaatttgccgggaaatgggacgaattcaag
ttcggccctatccgcgagagccaagtctctcgcgcgatgacgcgccgctacttcaaggac
ttggatacttacgctgaaagtgacatcgtcatcgttggtgcaggatcctgcggccttagc
accgcatatgtcttgggcaaggctcgccctgacttgaaaatcgccattatcgaggcttcc
gtctcccctggtggtggtgcatggctcggcggccagctgttctctgccatggtcctccgc
aaaccggcggatcgcttcctcgatgacctgggaattccgtatgagcaagagccctccaac
ccgaacctggtagtgatcgagcacgccgcgctcttcacttcaaccttgctctccaaagtc
ctctcattcccgaacatcaagctgttcaatgccacctgcgttgaggacctagtcacccgc
ccagcaccactgtccggtgacccggagggactccgcattgctggcgttgtgaccaactgg
acacttgtgactctccatcatgacgaccattcatgcatggaccccaacaccatcaacgcg
ccggtggtcattagtactaccggccacgatggaccgttcggtgccttctgcgctaagcgt
ctagtatccatgtctgcgattgagaaactcggtggcatgcgtgggcttgatatgaattcg
gctgaagaggcgatcgtgaaaaatacccgggaggtggtaaagggattgataattgggggt
atggaactgagtgaaattgacgggtggcatcggatggggccgattttttcggctatgatg
cttagcggggtgcgagctgcggaagttgcactggagatttttgaggagaggaagaaggag
tgtgcagagtag

DBGET integrated database retrieval system