KEGG   Paracoccidioides lutzii Pb01: PAAG_01970Help
Entry
PAAG_01970        CDS       T02230                                 

Definition
(RefSeq) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
pbl00970  Aminoacyl-tRNA biosynthesis
pbl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PAAG_01970
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pbl03029]
    PAAG_01970
Enzymes [BR:pbl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PAAG_01970
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PAAG_01970
Mitochondrial biogenesis [BR:pbl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PAAG_01970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-GeneID: 9099528
NCBI-ProteinID: XP_002796082
UniProt: C1GTX5
Position
Unknown
AA seq 602 aa AA seqDB search
MIRQCLSRRAAYPCYRIVAGGTEPTGCLYPQSCRISRRGRDWSSTSRRAIDTQTSGASNG
ADYVPLRQQLKEQARAKRAAKRKGEVSPPEHEDWELTVGIEIHAQLDTDTKLFSRASAAI
DDVPNSNVALFDVALPGSQPLFQPATLIPALRAAIALNCDVQRVSRFDRKHYFYQDQPAG
YQITQYYEPYAKNGSIWLGSHDGIAKEDGVGVEIGIKQIQMEQDTAKSQELPSSTYLLDF
NRVSRPLIEIITLPQIHSPATAAACVRKIQTILQSVGAVTTGMEMGGLRADVNVSVRKRS
EGVGDHQYHGVTGLGQRTEIKNLSSFKAVEDAIIAERDRQIAVLRAGGAIEGETRGWTLG
STETRKLRGKEGEVDYRYMPDPDLGPVIIGYDVLCELKAKLPVLPDALLHNLVQDPKYGL
SIDDAKTLIELDDGDRLDYYKDAVDILVTLQKDLSDDFSGGKVVGNWVLHELGGLLTKSN
LHWDSERVPAQSLAEIINLLSRNKITGSTAKSLFAMVFDGDKRSIGQIVEDENLLLQSLS
REEYIALAEEVMRQNPKMVMEICEKRQLGKIGWLVGQIKRIGDRNRVEAQKAEEILRELI
LK
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgatccgacaatgcctatcccgacgtgctgcttatccctgttaccgaattgtagcgggt
ggaactgagcccacgggctgtctctatccccagagctgccgcatatcaaggagggggagg
gattggtcctctacttctcgacgggctatagatacccagacgtctggtgcgagcaacggc
gccgactacgttcctttgcgtcaacaattgaaagagcaggctagagcgaagcgggcagcg
aaaaggaagggcgaagtttcaccgccagaacatgaggattgggaactgactgtgggcatt
gagatacatgcgcaattagatacggatacaaaactattttcaagagcctctgcggccatt
gatgatgtcccaaactcaaacgtagcactctttgatgttgcattgccaggaagccaaccg
ttgtttcaaccagccaccttgatacccgcactacgcgcggccattgccctgaactgcgat
gtgcagcgggtcagtcgttttgacagaaaacattacttctatcaggaccagcctgcgggc
tatcaaataacccaatactacgaaccgtacgcgaaaaatggcagcatttggttgggatca
cacgatggcattgctaaggaggacggggtcggcgttgaaatcggtataaaacaaatacag
atggagcaggatacggcgaaatcacaagaacttccatcgtccacataccttcttgacttc
aaccgtgtttcgcgccctcttatcgaaataataacgctaccgcagatccactcgccagca
acagccgctgcttgcgtgagaaaaatccagacgatccttcagtccgtcggagcagtgaca
acggggatggaaatgggaggcctaagggctgacgttaacgtatctgtaagaaaacggagc
gagggggttggtgaccatcaataccacggagtaacaggactcggccaacgaaccgaaatc
aaaaatctaagcagtttcaaagctgtcgaagatgctatcattgcagaacgagaccgtcaa
atcgcggtacttagagcaggtggcgccattgagggagagacacgaggctggacacttggc
agcaccgagaccaggaaactacgggggaaggagggggaagtggactaccgatacatgccg
gatcctgatctggggccagtgataataggatacgatgttctttgtgaactcaaggcgaag
ctgccagttctgcccgatgcgctcttacataatcttgtccaagatccgaaatacggactc
tctattgacgatgccaagacattgattgaactcgatgacggagatcggctagattactat
aaagatgctgttgatattctagttaccctccaaaaggacctatccgacgatttcagtggc
gggaaggtggttggcaattgggtgctgcatgaactcggaggcctgctaaccaaatcaaac
ctccactgggactcagaacgggtcccagcacaaagtctagcggaaattatcaacctgctc
tcccgaaataaaataaccggcagcacggcgaaatctctctttgcaatggtgtttgacggc
gacaagcggtctatcggtcagattgtggaggacgaaaatctccttctccaaagcctttcc
cgggaagaatacatcgcgctagccgaggaggttatgcgccagaaccccaagatggtgatg
gaaatctgcgagaaacgccagctgggcaagattggctggttggttggacagattaagcgg
attggtgataggaatagagtcgaggcgcaaaaggccgaggagattctacgggagcttata
cttaaatag

DBGET integrated database retrieval system