KEGG   Paracoccidioides lutzii Pb01: PAAG_03243Help
Entry
PAAG_03243        CDS       T02230                                 

Definition
(RefSeq) hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
pbl00010  Glycolysis / Gluconeogenesis
pbl01100  Metabolic pathways
pbl01110  Biosynthesis of secondary metabolites
pbl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAAG_03243
Enzymes [BR:pbl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PAAG_03243
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 9097795
NCBI-ProteinID: XP_002794698
UniProt: C1GXW0
Position
Unknown
AA seq 318 aa AA seqDB search
MERANKPTAIPVHSPLPQPTISVQEDQVQASLASGESVTVNLFGATVVSWKLANGEEQLF
LSEKAALDGSKPIRGGIPLVFPVFGPPPKGHATSALPQHGFARNVHWEFLGKSTSESEGQ
NGDSSVKLDFGLSMSMLSDKFKKDWPYDFGLLYSVTLSKGSLITSLQVQNKGAQPFDFQA
LLHSYFRVKDITKIRLLNLQSATYVDKLLNASVHVESSPALSFTQETDRIYQSLDPTVPI
IVADADNNNSPIFSITRESLNDVVVWNPWIEKAKGMADFAPDDGYKNMICVEAGSVAGWQ
TLEAGESWEGGQTVRSKL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgcaaataaacccacagcaattcctgtgcactctccgctcccgcagcccact
atctccgtgcaagaagatcaagtccaggcttcactggcctccggcgaatccgtcactgtc
aatttgtttggcgcgactgtagtgtcctggaagcttgccaatggcgaggaacagcttttt
ttgagcgagaaagctgcgctggatgggtccaagccaatacgcggcgggattccattggtt
ttccccgttttcggccctcctcccaaaggccacgcaacttccgcactcccccagcacggg
ttcgcccgcaatgtacattgggaatttcttgggaaatcgacttccgaatcagagggacag
aatggcgatagcagcgttaagcttgatttcggcctgtcgatgagcatgttgagtgataag
ttcaagaaggattggccgtacgatttcggtctcctgtacagtgttacactgagcaagggc
agcctcatcacgtcgctgcaggtccagaataaaggtgcacagccgtttgatttccaggct
ttgctacattcgtacttcagggtcaaggatattaccaaaattcgccttctaaacctgcag
tcagcaacatacgttgacaaactgctcaacgcatcggttcatgtcgaatcctccccggcc
ctctcattcacccaagaaacggatcgcatctatcaatctcttgatccaaccgtgcccatc
atcgttgccgacgcagacaacaacaacagccccatcttctcaattacccgcgaatctctg
aatgatgtcgtggtgtggaacccttggatcgagaaggcgaagggaatggccgatttcgca
cctgatgatggttataagaacatgatttgcgttgaggccggatcagttgcgggatggcag
acgttggaagcaggtgagtcgtgggagggtggccagacagtgaggagtaaactctga

DBGET integrated database retrieval system