KEGG   Paracoccidioides lutzii Pb01: PAAG_03773Help
Entry
PAAG_03773        CDS       T02230                                 

Definition
(RefSeq) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
pbl00260  Glycine, serine and threonine metabolism
pbl01100  Metabolic pathways
pbl01110  Biosynthesis of secondary metabolites
pbl01130  Biosynthesis of antibiotics
pbl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pbl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAAG_03773
Enzymes [BR:pbl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     PAAG_03773
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 9097436
NCBI-ProteinID: XP_002794180
UniProt: C1GZ29
Position
Unknown
AA seq 413 aa AA seqDB search
MTSQTLIETVNHSARAATHDFRSDTVTLPSSRMLASTITQAPRFGDDTFFQDGPTNSLEA
YVGELTGMGNALFVSTGTMGNQLALRALLQQPPYSVVCGRHSHIFEHECGMSSIFSQAHL
IPVMPSSPKGNCQPKQQLYMPLEDIIPNIVPDSGDPHYAPTRVIALENTHGGIITPVPEV
KRISEYARRNGIKLHMDGARLWNACYPPSSVNLPPAEAAEVAKTLLREYCSHVDTVSMCF
SKSLGAPSGSILVAKSPEIIARARHLRKALGGAMRQVGILTAPAFIAIDEVFLAGEPMLR
ANAVARELEKEWIALGGSVMPGLAQETNMVWLDLNMAGVSGEEFERIAKKEGVDVFAPRI
VTHYQISTDGIITLKRVLKQIIELGKNRGTAKAPHTLEEKYIGAKFSYGTEER
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgacttcacagacattaattgagacagtaaatcatagcgctcgcgctgcaactcatgac
ttccgaagcgacaccgtcacactcccaagcagccgcatgctcgcatcaaccatcacccaa
gcgccgcgctttggggacgacaccttcttccaagacgggcccaccaattctctagaggct
tacgtcggggagttgacagggatggggaatgctctttttgtctccacggggacaatgggc
aatcaattagctctacgcgctctcttgcaacagccaccatactccgtcgtttgtggccgg
catagtcacatcttcgagcatgagtgcggcatgtcttctattttttcgcaggcgcatttg
attcctgtgatgcccagttctcctaagggcaattgccaaccgaaacagcagttatatatg
cctctggaagatatcatccctaatatagtgcccgactccggcgatccgcactatgcacca
actagagtgattgcattggaaaatacacatggcggtatcatcactcccgtacctgaagtc
aagcgaatatcagagtatgcccggagaaatggcataaaactacacatggatggcgcccgg
ttatggaatgcatgctacccaccctcaagcgtcaacctgccacccgcagaggcagcggag
gttgccaaaactctgctccgtgaatactgctcacacgtcgacactgtcagcatgtgtttc
tcgaaatctctaggtgcaccttctggctctatcctggtggctaagtcgccagagatcatc
gcgcgtgcccgccatctgcgcaaggcgctgggcggcgcgatgagacaggtcggtatcctc
acggcgcctgcgttcattgctattgatgaggtgtttcttgctggtgaacctatgttgcgg
gccaatgcggtggcgagggagctggagaaggaatggattgcgttgggagggtcagttatg
cccggtctagcccaagagacgaatatggtatggttggatttgaacatggctggggtgtct
ggggaggaattcgagcggattgcgaagaaggaaggggtggatgtttttgctccgaggatt
gttacccattatcaaataagcacggatggaatcattaccctgaagcgggtacttaagcag
attatagaattgggcaagaataggggcacggcaaaagcgccgcacacgttagaggagaag
tacattggagcgaaattctcctacggaactgaagaacggtga

DBGET integrated database retrieval system