KEGG   Paracoccidioides lutzii Pb01: PAAG_06268Help
Entry
PAAG_06268        CDS       T02230                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
pbl  Paracoccidioides lutzii Pb01
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 9095249
NCBI-ProteinID: XP_002792003
UniProt: C1H5S3
Position
Unknown
AA seq 156 aa AA seqDB search
MSLEMTMACMVYAMLEQEELNEENERKRKLKELVRLHPELKRPTTNFTPLLNPGDAAKGA
GLFKTRCAQCHTLEAGGANKVGPNLHGLFGRKSGTVEGYSYTDANKQRGVEWNEQSLFEY
LENPKKYIPGTKMAFGGLKKPKDRNDLITYLQNETK
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgagcctggagatgacgatggcgtgcatggtgtacgcgatgctcgagcaggaggagcta
aacgaagaaaacgaacgcaagagaaagctgaaggaactcgttcgactgcatccggagctt
aagaggccgactactaattttacccctcttctcaatccaggtgacgctgctaagggtgct
ggtctcttcaagactcgctgcgctcagtgccacaccctcgaggctggcggtgctaacaag
gtcggccccaacttgcacggacttttcggccgcaagagtggtactgtcgaagggtactcc
tacaccgacgcaaacaagcagagaggtgtcgagtggaacgaacagtctttgtttgaatac
cttgagaacccaaagaagtacatccctggcaccaagatggctttcggtggcctcaagaag
cccaaggaccgcaacgatctgatcacctacctccaaaacgaaaccaaataa

DBGET integrated database retrieval system