KEGG   Paracoccidioides lutzii Pb01: PAAG_06473Help
Entry
PAAG_06473        CDS       T02230                                 

Definition
(RefSeq) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
pbl00051  Fructose and mannose metabolism
pbl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PAAG_06473
Enzymes [BR:pbl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     PAAG_06473
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 9094821
NCBI-ProteinID: XP_002791734
UniProt: C1H6T2
Position
Unknown
AA seq 388 aa AA seqDB search
MGKKAVHFGGGNIGRGFVGEFLHESGYEVVFVDVMDSVIDALQKASSYTVTEISGEGEHK
KVIENYRAINSKHNLDDVIKEISTADVVTCAVGPNILKFIAPPIAKGIDIRTQPKPLAVI
ACENAIGATDTLHGFIKDNTDESRRDSLPSRAQFANSAIDRIVPTQDPNSGLDVKIEKFY
EWVVEKTPFGDVGHPDIKAIHWVDNLEPYIERKLFTVNTGHATAAYFGYNAGKPTIHDAL
KDERIRSQVNAVLAETSALIVEKHHIPAEEQHDYVQKIITRISNPYLEDVVQRVGRAPLR
KLSRKERFIGPAAQLAERGQQVDALMGAVEEALKFQNVPDDEESFELHKILKELSAADAT
TKLTDLEPDHPLYPRVLEKVTKVQSETK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaaaggcagtgcactttggaggtggcaacattggccgtggattcgttggggag
ttcctccatgagtctggctatgaagtcgtctttgtcgatgttatggacagcgtcatagat
gctctccagaaagcctcatcatacacggtcacggaaatcagtggagaaggcgaacacaag
aaagtcatcgagaattatcgggccatcaactccaaacacaatctcgacgacgtcatcaag
gagatatccactgccgatgtcgtcacttgtgctgttggccctaacattctgaagttcatc
gccccacccatcgccaagggtatcgatattcgaacccagcccaagccactggctgtgatt
gcctgcgaaaacgcaatcggtgccaccgacactctacatggcttcatcaaggacaacact
gacgaatcccgtcgtgactctctccccagccgtgcccagttcgccaactccgctatcgac
cgcattgtgcccacccaggaccccaattccggtcttgacgtcaaaatcgaaaagttttac
gagtgggtcgtggaaaagactccctttggcgacgtcgggcacccggatatcaaggctatc
cactgggtggacaatctggaaccttacattgagcgcaagctgttcaccgtcaacaccggc
catgcaaccgctgcctacttcggctataatgctggcaaaccgacaatccacgatgcgttg
aaggacgagagaatccggagccaagtcaacgcggtcctggcagagacctcagccctgatc
gtcgagaagcaccacatcccggccgaagaacaacacgattacgtccagaagatcatcacc
cgcatctctaacccgtatctcgaagacgtcgtgcagcgtgttggacgtgctccgctccgc
aagctgtctcgcaaggaacgcttcatcggaccagctgcccagctcgctgagcgtggacaa
caggtcgacgcgttgatgggagcggtcgaggaggcgttgaagttccagaacgtgcctgat
gacgaggagagtttcgagctgcacaagatcctgaaggagctgtccgccgcagacgcaacg
accaaactgacagacctggagccagatcacccgctgtacccgcgcgttctcgagaaagtg
accaaggtccaaagcgaaacgaagtag

DBGET integrated database retrieval system