KEGG   Pseudomonas balearica: CL52_08300Help
Entry
CL52_08300        CDS       T03573                                 

Definition
(GenBank) succinyl-CoA synthetase subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
pbm  Pseudomonas balearica
Pathway
pbm00020  Citrate cycle (TCA cycle)
pbm00640  Propanoate metabolism
pbm00660  C5-Branched dibasic acid metabolism
pbm01100  Metabolic pathways
pbm01110  Biosynthesis of secondary metabolites
pbm01120  Microbial metabolism in diverse environments
pbm01130  Biosynthesis of antibiotics
pbm01200  Carbon metabolism
Module
pbm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pbm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pbm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CL52_08300
   00640 Propanoate metabolism
    CL52_08300
   00660 C5-Branched dibasic acid metabolism
    CL52_08300
Enzymes [BR:pbm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CL52_08300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: AJE15049
UniProt: A0A1G9RFL2
Position
1775912..1776799
Genome map
AA seq 295 aa AA seqDB search
MSILINKDTKVICQGFTGSQGTFHSEQAIAYGTRMVGGVTPGKGGTMHLGLPVFNTVKEA
VEATGADASVIYVPAPFCKDSILEAAFGGIKLIVCITEGIPTLDMLEVKIKCDELGVRLI
GPNCPGVITPGECKIGIQPGHIHQPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTCVGIGG
DPIPGSSFIDILELFQNDPQTEAIVMIGEIGGSAEEEAAAFIKANVTKPVVSYIAGVTAP
AGKRMGHAGAIISGGKGTAEEKFAALQDAGVRTVRSLADIGKALADVTGWEMKGA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagcattctgatcaacaaggacaccaaggtcatctgccaaggctttaccggctcacaa
ggaacgttccactccgagcaggccatcgcctatggcacgcgcatggtcggtggggtgacg
cctggcaagggcggcaccatgcatcttggtctgccggtgttcaatacggtcaaggaagcc
gtggaagccaccggcgccgatgcctcggtaatctacgtaccggcacctttctgcaaggac
tcgatcctcgaagccgcgtttggcggcatcaagctgatcgtatgcatcaccgagggcatc
ccgacgctggatatgctggaagtcaagatcaagtgcgatgagctcggtgtgcgtctgatc
ggtccgaactgcccaggtgtaatcaccccgggtgaatgcaagatcggcattcagcccggc
cacatccaccagccgggcaaggtaggcatcgtttcgcgttccggcacgctgacctacgag
gcggtcaaacagacgaccgatgcgggcttcggccagtccacctgtgtcggcattggtggc
gatccgattcccggctcgagcttcatcgacatcctggagcttttccagaacgaccctcag
accgaggcaatcgtcatgatcggcgagatcggtggttcggccgaggaagaggcggcggcc
ttcatcaaggccaacgtgacaaagccggtggtgtcgtacatcgcgggcgttaccgcaccg
gcgggcaagcgaatggggcatgccggagcgatcatctccggaggcaagggcacggcggag
gagaagttcgctgcgctgcaggacgcgggcgtgcgaacggtgcgttcgctggccgatatt
ggcaaggccctggctgacgtgacaggttgggaaatgaagggcgcctga

DBGET integrated database retrieval system