KEGG   Pseudomonas balearica: CL52_08585Help
Entry
CL52_08585        CDS       T03573                                 

Definition
(GenBank) aconitate hydratase
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
pbm  Pseudomonas balearica
Pathway
pbm00640  Propanoate metabolism
pbm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CL52_08585
Enzymes [BR:pbm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     CL52_08585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: AJE15105
UniProt: A0A1G9RIM8
Position
1833564..1836170
Genome map
AA seq 868 aa AA seqDB search
MNTDYRKSLPGTQLDYFDVRAAVEDIQPGAYDTLPYTSRVLAEQLVRRCDPAMLTDSLKQ
IIERKRDLDFPWYPARVVCHDILGQTALVDLAGLRDAIAEQGGDPSKVNPVVPTQLIVDH
SLAVEAAGFDPDAFAKNRAIEDRRNEDRFHFIEWTKTAFKNVDVIPAGNGIMHQINLEKM
SPVIQARGGVAFPDTCVGTDSHTPHVDALGVIAIGVGGLEAETVMLGHPSMMRLPDIVGV
KLTGKRQPGITATDIVLALTEFLRKERVVGAYVEFFGEGADSLSIGDRATISNMCPEYGA
TAAMFYIDGQTIDYLKLTGREPEQVALVEQYAKQTGLWASALESAEYERVLEFDLSSVVR
NMAGPSNPHRRLPTSALHERGIADEAKLAAARAEEAEGLLPDGAVIIAAITSCTNTSNPR
NVVAAGLLAKKANELGLARKPWVKTSFAPGSKVAKLYLEEAGLLTELEKLGFGIVAYACT
TCNGMSGALDPKIQQEIIDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAG
TVRFDIEQDVLGTDRNGNPITLKDLWPSDEEIDAIVASSVKPEQFKQIYIPMFDLGAVEE
AKSPLYDWRPMSTYIRRPPYWEGALAGERTLKGMRPLAVLGDNITTDHLSPSNAILPDSA
AGEYLAKMGLPEEDFNSYATHRGDHLTAQRATFANPKLLNEMCRDEAGEVIQGSLARVEP
EGQVMRMWEAIETYMNRKQNLIIVAGADYGQGSSRDWAAKGVRLAGVEVIVAEGFERIHR
TNLIGMGVLPVEFKPGTTRLTLGLDGTETYDIEGDLSPRCDLTLVIHRTNGEVARVPVTC
RLDTAAEVSVYQAGGVLQRFAKDFLGQA
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgactatcgcaaatccctgcccggcacccagctggattacttcgatgtccgc
gcggcggtcgaggatatccagcccggcgcctacgacaccttgccctacacctcgcgcgtc
ctggccgagcaactggtgcgccgttgcgatccggccatgctgaccgactcgctcaagcag
atcatcgagcgcaagcgcgacctggactttccctggtatccggcgcgcgtggtctgtcac
gacattcttggccagaccgcactggtcgatctggccggcctgcgcgatgcgatcgccgaa
cagggcggtgatccgtccaaggtcaatccggtagtaccgacccagctgatcgtcgaccac
tcgctggccgtggaagccgcgggcttcgacccggacgcgttcgccaagaaccgcgccatc
gaggatcgccgcaacgaagatcgcttccacttcatcgagtggaccaagaccgcgttcaag
aacgtcgacgtgatccccgccggcaacgggatcatgcaccagatcaacctggagaagatg
tcgccggtgatccaggcgcgaggcggcgtcgcattcccggatacctgcgtcggtaccgac
tcccacaccccgcacgtggatgcgctgggtgtgatcgcgatcggcgtcggcggtctggaa
gccgaaaccgtgatgctcggtcatccgtcgatgatgcgcctgcccgatatcgtcggtgtc
aagctcaccggcaagcgtcagcccggcatcaccgccaccgacatcgtgctcgccctgacc
gagttcctgcgcaaggaacgcgtggtgggtgcctacgtcgagttcttcggcgaaggcgct
gacagcctgtcgatcggcgatcgcgcgaccatttccaacatgtgccccgaatacggtgcc
accgcggcgatgttctacatcgacggtcagaccatcgactacctcaagctgaccggtcgt
gagccggaacaggtggcgctggtcgagcagtacgccaagcagaccgggctgtgggcttcg
gcgctggagtcggccgaatacgagcgtgtgctcgaattcgatctgtcgtcggtcgtgcgt
aacatggccggcccgtcgaacccgcaccgccgcctgccgacctctgcactgcacgagagg
ggcatcgccgacgaagccaagctggccgccgcccgtgccgaagaggccgagggcctgctg
ccggacggcgcggtgatcatcgccgcaatcaccagctgcaccaacacctccaacccgcgc
aacgtggtcgccgccggcctgctggcgaagaaggccaacgagctggggctggcacgcaaa
ccctgggtcaagacgtcgtttgcgccgggctccaaggtcgccaagttgtacctggaggaa
gccggcctgctgaccgagttggaaaagctcggtttcggcatcgtcgcctacgcctgcacc
acctgtaacggcatgtccggcgcgctggatccgaagatccagcaggaaatcatcgaccgt
gacctgtatgccacggcggtgctgtccggcaaccgcaacttcgacggccgcatccatccg
tatgccaagcaggccttcctggcctcgccgccgctggtggtcgcctatgccatcgctggc
accgtgcgtttcgatatcgagcaggacgtgctgggtaccgaccgcaacggcaacccgatc
accctcaaggacctgtggccgtccgacgaggagatcgacgccatcgtggcctccagcgtg
aagccggagcagttcaagcagatctacattccgatgttcgatctgggcgcggtcgaggaa
gccaagagcccgctgtacgactggcgcccgatgtccacctacattcgccgaccgccgtac
tgggaaggtgctctggccggcgagcgtacgctcaagggcatgcgcccgctggccgtgctg
ggcgacaacatcaccaccgaccacctgtcgccatccaacgcgatcctgccggactcggcg
gcgggcgagtatctggcgaagatgggcctgcccgaggaggacttcaactcctacgccact
caccgcggcgaccacctgaccgctcaacgtgccacgttcgccaacccgaagctgctcaat
gaaatgtgccgcgacgaggcgggcgaagtgatccagggctcgctggcgcgcgtcgagccg
gagggccaggtgatgcgcatgtgggaagccatcgaaacctacatgaatcgcaagcagaac
ctgatcatcgtcgccggggccgattatgggcagggcagctcgcgtgactgggcggccaag
ggggtgcgtctggccggcgtggaggtgatcgtcgccgaaggcttcgagcgcattcaccgt
accaatctgatcggcatgggcgtgctgccggtggagttcaagccgggcactacgcgcctg
acgctgggcctcgacggtaccgagacctacgacatcgagggcgatctgtcgccgcgctgc
gatctgactctggtcatccatcgcacgaatggcgaggtagcccgcgtgccggtgacctgc
cgtctcgacaccgctgccgaggtcagcgtttaccaggctggcggcgtgctgcagcgcttc
gccaaggacttcctcggccaggcctga

DBGET integrated database retrieval system