KEGG   Pseudomonas balearica: CL52_10100Help
Entry
CL52_10100        CDS       T03573                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pbm  Pseudomonas balearica
Pathway
pbm00071  Fatty acid degradation
pbm00072  Synthesis and degradation of ketone bodies
pbm00280  Valine, leucine and isoleucine degradation
pbm00310  Lysine degradation
pbm00362  Benzoate degradation
pbm00380  Tryptophan metabolism
pbm00620  Pyruvate metabolism
pbm00630  Glyoxylate and dicarboxylate metabolism
pbm00640  Propanoate metabolism
pbm00650  Butanoate metabolism
pbm00900  Terpenoid backbone biosynthesis
pbm01100  Metabolic pathways
pbm01110  Biosynthesis of secondary metabolites
pbm01120  Microbial metabolism in diverse environments
pbm01130  Biosynthesis of antibiotics
pbm01200  Carbon metabolism
pbm01212  Fatty acid metabolism
pbm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pbm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CL52_10100
   00630 Glyoxylate and dicarboxylate metabolism
    CL52_10100
   00640 Propanoate metabolism
    CL52_10100
   00650 Butanoate metabolism
    CL52_10100
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CL52_10100
   00072 Synthesis and degradation of ketone bodies
    CL52_10100
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CL52_10100
   00310 Lysine degradation
    CL52_10100
   00380 Tryptophan metabolism
    CL52_10100
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CL52_10100
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CL52_10100
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CL52_10100
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pbm04147]
    CL52_10100
Enzymes [BR:pbm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CL52_10100
Exosome [BR:pbm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CL52_10100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJE15381
UniProt: A0A1G9RZC5
Position
complement(2191776..2192960)
Genome map
AA seq 394 aa AA seqDB search
MKQDPIVIVSCARTPMGGFQGDLKSLTAPQLGAAAIRAAVERAGLPPENVQDVLMGCVLP
AGQGQAPARQAALGAGLTRATTCTTVNKMCGSGMQTAILAHDQLLAGSSDIVVAGGMESM
TNAPYLLEKARAGYRMGHGRVLDHMFLDGLEDSFDKGRLMGSFAEECADAFGFTREQQDA
YAIESLCRAQAAIAGGAFADEIVALDVTDGKQQRQVRDDEQPPKASLDKIPQLRPAFREG
GTVTAANSSSISDGAAALVMMRRSEAERWGLQAQAVIHGHAAYADAPSRFTTAPIGAIGK
LMERTGWRLADVDLIEINEAFAVVPMAAMRELDIDHARLNVNGGACALGHPVGASGARIL
ATLIHALRARQLRRGVAAICIGGGEATAMAIELI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggatccgatcgtcatcgtcagttgcgcccgcacgcccatgggcggcttccag
ggcgacctcaagagcctgacggcgccacaattgggcgctgctgccatccgcgctgccgtc
gagcgtgccggcctgccgccggagaacgtccaggacgtgctgatgggttgcgtactgccc
gccgggcagggccaggcaccggcacgccaggccgctctaggcgccggcctgacccgcgcc
acgacctgtaccacggtcaacaagatgtgcggctcgggcatgcagaccgccatcctcgcc
catgaccagctgctggccggcagcagcgacatcgttgtcgccggcggcatggagagcatg
accaacgccccctatctgctggagaaggcccgagccggctaccgcatggggcacggccgg
gtgctcgaccacatgttcctcgacggcctggaagactcgttcgacaagggccggttgatg
ggcagcttcgccgaggagtgcgccgatgcctttggcttcacccgtgagcagcaggacgcc
tatgccatcgaatcgctatgccgggcgcaggccgccattgccggcggcgcgttcgccgac
gaaatcgtcgcgctggacgtgaccgatggcaaacagcagcgccaggtgcgcgatgacgag
cagccgcccaaggcgtcgctggacaagatcccgcagctgcgcccggcgtttcgtgaaggc
ggcacggtgaccgcggccaactccagctcgatttccgacggcgccgccgcgctggtgatg
atgcgccggtccgaagccgaacgctggggcctgcaggcgcaggcggtgatccacggccac
gcggcctatgccgatgcccccagccgcttcaccaccgcgcccatcggggcgatcggcaag
ctcatggaacgcaccggctggcgcctggccgacgtcgacctcatcgagatcaacgaagcc
tttgccgtggtgccgatggcggcgatgcgcgagctggacatcgatcatgcgcggctcaac
gtcaatggcggcgcctgtgctctgggccaccccgttggcgcttccggcgcgcgcattctc
gcgacgctcattcatgcgctacgcgcgcgtcaattgcgccgcggcgtggcagccatctgc
atcggtggcggcgaagcgacggcgatggccatcgaactgatctga

DBGET integrated database retrieval system