KEGG   Pseudomonas balearica: CL52_10505Help
Entry
CL52_10505        CDS       T03573                                 

Definition
(GenBank) S-(hydroxymethyl)glutathione dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
pbm  Pseudomonas balearica
Pathway
pbm00010  Glycolysis / Gluconeogenesis
pbm00071  Fatty acid degradation
pbm00350  Tyrosine metabolism
pbm00625  Chloroalkane and chloroalkene degradation
pbm00626  Naphthalene degradation
pbm00680  Methane metabolism
pbm01100  Metabolic pathways
pbm01110  Biosynthesis of secondary metabolites
pbm01120  Microbial metabolism in diverse environments
pbm01130  Biosynthesis of antibiotics
pbm01200  Carbon metabolism
pbm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pbm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CL52_10505
  09102 Energy metabolism
   00680 Methane metabolism
    CL52_10505
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CL52_10505
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CL52_10505
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CL52_10505
   00626 Naphthalene degradation
    CL52_10505
Enzymes [BR:pbm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CL52_10505
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     CL52_10505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Met_10 MinC_C AlaDh_PNT_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: AJE15446
UniProt: A0A1G9TCE8
Position
complement(2280275..2281384)
Genome map
AA seq 369 aa AA seqDB search
MKSRAAVAFGPGKPLEIVEIDVEPPRKGEVLVRITNTGVCHTDAFTLSGEDPEGVFPAVL
GHEGAGIVVEVGEGVTSVKPGDHVIPLYTAECGECLFCKSGKTNLCVAVRATQGKGVMPD
GTTRFSYNGQPIYHYMGCSTFSEYTVVAEVSLAKINPDANPEHVCLLGCGVTTGIGAVHN
TAKVQPGDSVAIFGLGGIGLAAIQGARQAKAGRIIAIDTNPAKFELARTFGATECLNPKD
FDKPIHEVLIEMTGWGVDHTFECIGNVNVMRSALEAAHRGWGQSIVIGVAGAGKEISTRP
FQLITGRTWKGSAFGGVKGRTQLPGMVEDAMKGEIDLAPFVTHTMGLDDINKAFDLMHEG
KSIRTVIHY
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcacgtgcagcagttgccttcgggcctggaaagccactggaaatcgtcgagatc
gacgtcgagccgccgcgcaagggcgaggtgcttgtcaggatcacgaataccggcgtttgc
cataccgacgccttcaccctgtcgggcgaggacccggaaggcgtgttcccggcggtgctg
ggtcatgagggcgccggcatcgtggtcgaggtcggcgagggcgtgacctcggtcaagccg
ggtgaccacgtgatcccgctgtacaccgccgagtgcggtgagtgcctgttctgcaagagc
ggcaagaccaacctgtgcgtggcggtgcgcgccacccagggcaagggcgtgatgcccgat
ggcaccacccgcttcagctacaacggccagccgatctaccactacatgggctgctcgacc
ttcagcgaatacacggtggtggccgaagtctcgctggccaagatcaacccggacgccaat
cccgagcatgtctgcctgctgggttgcggtgtgaccaccggcatcggcgctgttcacaac
acggccaaggttcagccgggtgactctgtggccatcttcggcctcggcggcatcgggctc
gctgcgattcagggggcacgccaggccaaggcaggtcgcatcatcgccatcgacaccaat
ccagcgaagttcgagctggctcgtaccttcggcgcgaccgaatgcctcaacccgaaggac
ttcgacaagccgattcacgaggttctcatcgagatgaccggttggggtgtcgatcacacc
ttcgagtgcatcggcaacgtcaacgtgatgcgctcggcactggaagcagcacatcgtggc
tggggccagtcgatcgtcatcggcgtggctggtgcaggcaaggaaatttcgacgcgcccg
ttccagttgatcaccggtcgcacctggaagggctcggctttcggcggggtcaagggccgc
actcaacttcccggcatggtggaggacgcaatgaaaggcgagatcgatctcgccccgttc
gtcacccacaccatgggcctcgacgacatcaacaaggccttcgacctgatgcatgaaggc
aagtcgattcgcacggtgatccactactga

DBGET integrated database retrieval system