KEGG   Pseudomonas balearica: CL52_11980Help
Entry
CL52_11980        CDS       T03573                                 

Definition
(GenBank) beta-hexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pbm  Pseudomonas balearica
Pathway
pbm00520  Amino sugar and nucleotide sugar metabolism
pbm01100  Metabolic pathways
pbm01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pbm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CL52_11980
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CL52_11980
Enzymes [BR:pbm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CL52_11980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: AJE15714
Position
complement(2611612..2612607)
Genome map
AA seq 331 aa AA seqDB search
MQGSLMLDIGGTWLTAEDRQLLRQPQVGGLILFARNIDHPRQVLDLCRAVRAERPDLLIA
VDQEGGRVQRLRQGFVRLPAMREFAHHSDAVELARACGWLMATEVLAAGLDFSFAPVLDL
DHQRSAVIGARAFEAAPERAADLAAAFIGGMHAAGMSATGKHFPGHGWAEADSHVAIPRD
ERSLEEIRQCDLLPFRRLAPTLDAVMPAHVIYPQVDSQPAGFSQRWLQEVLRGELGFSGV
IFSDDLSMAGAHVAGDAAARIEAALSAGCDMGLVCNDRAAAELAVSALQRLAVKPSPRLA
RMRARSVIAQDYKQNPRWLSALGALRGAGLV
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggttcattgatgctggatatcggcggcacctggctgactgccgaggatcgccag
ttgctgcgccagccgcaggtcggcggcttgatcctgttcgcgcgcaacatcgaccatcct
cgccaggtgctggatctctgccgggccgtgcgcgccgagcgcccggacttgctgattgcc
gtcgatcaggaaggtggtcgcgtccagcgcttgcggcagggcttcgtcagattgccggcg
atgcgcgagttcgcccaccactcggatgccgtcgagcttgcccgggcctgcggctggttg
atggccacggaggtactcgcggccggcctcgatttcagctttgctccggtgctcgatctc
gatcatcagcgcagtgcggtaatcggtgcgcgggcgttcgaggcggcacccgagcgtgcg
gccgatctggccgccgcctttatcggcgggatgcatgcggcgggcatgtcggcgaccgga
aagcacttccccggccacggctgggccgaagccgattcgcacgtggcgataccgcgtgac
gagcgtagcctcgaggagattcgtcagtgcgatctgctgccgttccggcggctggcgcct
acgctggacgcagtgatgcccgcgcacgtgatctatccacaggtagattcccagccggcg
ggcttctcccagcgctggctgcaagaggtgttacgcggcgagctgggtttctccggcgtg
atcttcagcgacgatctttccatggccggcgcccatgtagcgggcgatgctgcggcgcgc
atcgaggccgcgctgagcgccggctgtgacatggggctggtgtgcaacgaccgggcagcc
gccgagctggccgtttcggcattgcagcggctggctgtaaagccctcgccgaggctggcc
cggatgcgcgcccgttccgtgattgcgcaggactacaagcagaacccgcgttggctttcc
gcgctcggtgcgttgcgcggcgcaggtctggtatga

DBGET integrated database retrieval system