KEGG   Pseudomonas balearica: CL52_14610
Entry
CL52_14610        CDS       T03573                                 

Definition
(GenBank) naphthalene 1,2-dioxygenase
  KO
K14579  naphthalene 1,2-dioxygenase subunit alpha [EC:1.14.12.12 1.14.12.23 1.14.12.24]
Organism
pbm  Pseudomonas balearica
Pathway
pbm00624  Polycyclic aromatic hydrocarbon degradation
pbm00626  Naphthalene degradation
pbm00627  Aminobenzoate degradation
pbm00633  Nitrotoluene degradation
pbm00642  Ethylbenzene degradation
pbm01100  Metabolic pathways
pbm01120  Microbial metabolism in diverse environments
pbm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pbm00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CL52_14610
   00633 Nitrotoluene degradation
    CL52_14610
   00642 Ethylbenzene degradation
    CL52_14610
   00626 Naphthalene degradation
    CL52_14610
   00624 Polycyclic aromatic hydrocarbon degradation
    CL52_14610
Enzymes [BR:pbm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.12  naphthalene 1,2-dioxygenase
     CL52_14610
    1.14.12.23  nitroarene dioxygenase
     CL52_14610
    1.14.12.24  2,4-dinitrotoluene dioxygenase
     CL52_14610
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: AJE16202
UniProt: A0A1G9QPI5
Position
3125741..3127090
AA seq 449 aa
MNYKNKNLVSESGLTQKHLIHGDEELFQRELETIFARNWLFLTHDSLIPSPGDYVTAKMG
VDEVIVSRQNDGSIRAFLNVCRHRGKTLVHAEAGNAKGFVCSYHGWGFGANGELQSVPFE
KELYGEALDKKCMGLKEVARVESFHGFIYGCFDEEAPSLKDYMGDAGWYLEPMFKHSGGL
ELIGPPGKVIIKANWKAPAENFVGDAYHVGWTHAASLRTGQSVFSSLAGNAALPPEGAGL
QMTSKYGSGMGVLWDGYSGVHSADLVPELMAFGGAKQERLNKEIGEVRARIYRSHLNGTV
FPNNSFLTCSGVFKVWHPIDANTTEVWTYAMVEKDMPEDLKRRLVDAVQRTFGPAGFWES
DDNDNMETESQNAKKYQSRDGDLVSNLGFGGDVYGDEVYPGIVGKSAIGETSYRGFYRAY
GAHISSSSWAEFEDVSKNWHTELAKTTDR
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgaattacaaaaataaaaacttggtgagtgaatctgggctgacccaaaaacacctgatt
catggcgacgaagaacttttccagcgcgaactggaaaccatttttgctcggaactggctt
ttcctgactcatgacagcctgattccgtcccctggcgactatgttacggcaaaaatgggg
gttgatgaggttatcgtctccaggcagaacgacggttcgattcgtgctttcctgaacgtt
tgtcgtcaccgtggcaagacgctggtacacgcagaagcaggtaatgctaaaggtttcgtt
tgcagctatcacggctggggcttcggcgctaacggtgaactgcagagcgtcccgtttgaa
aaagaactgtatggcgaggcgctcgacaagaaatgtatgggattgaaagaagtcgctcgt
gtagagagcttccatggcttcatctatggttgcttcgatgaggaagccccttctctcaaa
gactacatgggggacgctggctggtacctggagcctatgtttaagcattccggagggcta
gaactgatcggtcctccaggaaaggtcataatcaaggctaactggaaagcgcccgcggaa
aactttgtgggggatgcgtaccacgtgggttggacgcatgcggcttcgcttcgcacaggg
cagtcggtcttctcgtcgttagctggcaacgcagctttgcccccagaaggtgcaggtctg
caaatgacctccaaatacggcagcggcatgggtgtgttgtgggacggatattcaggcgtg
cacagcgcagacctggttccggaattgatggccttcggcggtgctaagcaggaacggctg
aacaaagaaattggcgaggttcgcgcacgaatctatcgtagccacctcaacggcaccgtt
ttcccgaacaacagttttctgacctgctcgggtgtcttcaaggtatggcacccgatcgac
gcaaataccactgaggtatggacctacgccatggtcgaaaaagacatgcccgaggatctc
aagcgccgcttggtcgacgcggttcagagaacgtttgggcctgctggcttctgggaaagc
gacgacaacgacaatatggaaacggaatcgcaaaacgccaagaaatatcagtccagagat
ggcgatctggtttccaacctgggtttcggcggggacgtatacggcgacgaggtttatcct
ggcatcgtcggcaaatcggcgattggcgagaccagttatcgtggcttctatcgggcttac
ggcgcgcacatcagcagctctagctgggctgaattcgaggatgtctctaaaaattggcat
accgaactggcaaagactactgatcgctaa

DBGET integrated database retrieval system