KEGG   Pseudomonas balearica: CL52_14615
Entry
CL52_14615        CDS       T03573                                 

Definition
(GenBank) naphthalene 1,2-dioxygenase
  KO
K14580  naphthalene 1,2-dioxygenase subunit beta [EC:1.14.12.12 1.14.12.23 1.14.12.24]
Organism
pbm  Pseudomonas balearica
Pathway
pbm00624  Polycyclic aromatic hydrocarbon degradation
pbm00626  Naphthalene degradation
pbm00627  Aminobenzoate degradation
pbm00633  Nitrotoluene degradation
pbm00642  Ethylbenzene degradation
pbm01100  Metabolic pathways
pbm01120  Microbial metabolism in diverse environments
pbm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pbm00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CL52_14615
   00633 Nitrotoluene degradation
    CL52_14615
   00642 Ethylbenzene degradation
    CL52_14615
   00626 Naphthalene degradation
    CL52_14615
   00624 Polycyclic aromatic hydrocarbon degradation
    CL52_14615
Enzymes [BR:pbm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.12  naphthalene 1,2-dioxygenase
     CL52_14615
    1.14.12.23  nitroarene dioxygenase
     CL52_14615
    1.14.12.24  2,4-dinitrotoluene dioxygenase
     CL52_14615
SSDB
Motif
Pfam: Ring_hydroxyl_B ACP_PD
Other DBs
NCBI-ProteinID: AJE16203
Position
3127106..3127687
AA seq 193 aa
MMINIQEDKLVSAHDAEEFLRFFNSGDEALQQEATTLLTREAHLLDIQAYRAWLEHCVDS
EVKYQIISRELRSASERRYQLNETMNIFNENYEQLEVRVAHQLDPQNWGNSPKVRFTRFI
TNIQAAMDENEDLLHIRSNLIVHRARRGNQVDVFYATREDKWKRGEDGARKLVQRLIDYP
ERTFQTHNVMIFM
NT seq 582 nt   +upstreamnt  +downstreamnt
atgatgattaatattcaggaagacaagcttgtctccgcccacgacgccgaagagtttctt
cgtttcttcaattccggcgacgaggctttgcaacaagaagctaccacgttgctaacccgg
gaagcgcatcttttagacattcaggcttaccgcgcctggttagagcactgcgtggactca
gaggtgaaatatcagattatctcacgcgaactgcgctcagcttccgagcgccgttaccag
ctcaatgaaaccatgaacattttcaacgagaattatgaacaactggaagttcgcgtagcg
catcaactggatccgcaaaactggggcaatagtccaaaggtgcgctttactcgtttcatc
acaaatatccaggctgcaatggacgaaaatgaagatttgcttcacattcgctccaaccta
attgttcaccgagcacgacgcggcaatcaagtcgatgtcttctatgccactcgggaggat
aaatggaagcgcggcgaagatggagcgcgtaagttggtccaacgattgattgattatcca
gagcgcacattccagacgcacaatgtgatgatctttatgtga

DBGET integrated database retrieval system