KEGG   Pseudomonas balearica: CL52_14635
Entry
CL52_14635        CDS       T03573                                 

Definition
(GenBank) aldolase
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
pbm  Pseudomonas balearica
Pathway
pbm00626  Naphthalene degradation
pbm01100  Metabolic pathways
pbm01120  Microbial metabolism in diverse environments
pbm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pbm00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    CL52_14635
Enzymes [BR:pbm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     CL52_14635
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-ProteinID: AJE16207
Position
3131378..3132382
AA seq 334 aa
MSNKTMKPARLTAEDIHGVWAIMPTPATPDASNWRSTNTVDLNETARIVEELIAAGVNGI
LSMGTFGECATLTWEEKRDYVSTIVETIRGRVPYFCGTTALNTREVIRQTREFMDMGASG
TMLGVPMWVKMDLPTAVQFYRDVAEAVPEAAIAIYANPEAFKFDFPRPFWAEMSKIPQVV
TAKYLGIGMLDLDLKLAPNIRFLPHEDDYYAAARINPERMTAFWSSGSMCGPATAIMLRD
AVDQAKSSGDWIKAKAISDDMRAADSTLFPRGDFSEFSKYNIGLEKARMDAAGWLTAGPC
RPPYNIVPEDYIAGALKSGKAWAALHAKYSKELK
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgtcgaataaaactatgaaaccagcgcgtcttactgccgaggatatccatggtgtctgg
gctattatgccaacgccggctactccggatgcttctaactggcgcagcactaacacagtt
gacttaaacgagactgctcgcatagttgaagaactgattgcggctggtgtcaacggaatt
ttaagtatgggcacttttggcgagtgcgctacgttgacctgggaggaaaaacgtgactat
gtttcgacgattgtcgaaaccattcgtggtcgcgtgccttatttctgcggcaccacggcc
ttgaatacccgcgaagtcatccgccaaactcgtgagtttatggatatgggcgccagcggt
accatgctcggtgtcccaatgtgggtgaagatggacctgcccacagcggtccagttctat
cgtgatgttgcagaggcggtaccggaggctgccattgcgatttacgctaaccctgaagcc
ttcaagttcgacttccctcgccccttctgggcagaaatgtccaaaattccgcaggtagta
actgccaaatatctaggcatcggaatgcttgacttggacctgaaattggcacccaacatc
cgcttccttccacacgaggatgactattacgcggccgcacgcatcaatcctgagcgcatg
accgcgttctggtcaagcggctccatgtgcggcccggctaccgccatcatgttgcgtgat
gcagtggatcaggccaagagcagcggtgactggatcaaggccaaagccatctccgatgac
atgcgcgcagccgattcgacattgtttccgcgtggcgacttttcggagttctcgaaatac
aacatcggacttgaaaaagcacgcatggatgcagctggctggctcacagctggaccatgc
cgtccgccctataacatcgtcccagaagactatattgctggcgcccttaagtcaggcaaa
gcttgggccgcactgcatgctaaatacagcaaggaattgaagtag

DBGET integrated database retrieval system